(data stored in ACNUC7421 zone)

EMBL: CP002343.PE403

CP002343.PE403       Location/Qualifiers
FT   CDS             complement(449567..450952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0417"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   kfl:Kfla_5626 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: Sugar ABC transporter substrate-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46965"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6S861"
FT                   /protein_id="ADU46965.1"
FT                   /translation="MNDNQGVTMSRRVLRTIALAGLTGALGLTACTPGSGGTAGPSEPA
FT                   PNASVTTDATSLGEVTLTVWDQEVRGGQEKQMSTLVSQFQQKYPNIKVDRVSRSFDDLT
FT                   KTLRLALSGKDAPDVVQANNTRSQMGAFVTAGELVNLDPWAKAYGWDQRYPASVRAVSS
FT                   YSPDGKTFGSGSLFGLPQVGEVVGIYYSRSKLESLGLQPPTTWAELDAALAAAKDKGEV
FT                   PLVLGNLEKWPAGHVFGVVQGRYVPADQIRALGFGQPGGDWTSPENVKAAQTLVDWVDR
FT                   GYFNSGFNGQDYDPAWQSFTKGEGVFLIAGSWLQADLSAAMKDDVGFMLPPPSEAGGTA
FT                   VTTGGTGLPFAITDKAVNKDAAAAYINFITSPEAMKVLAENGNLPVVETSQQAAPDALG
FT                   KDVFAAFDAVSRADGLVPYLDWATPTMGDTLGATLQDLLAKKLSPADALARLQEDYSEF
FT                   TSK"
     MNDNQGVTMS RRVLRTIALA GLTGALGLTA CTPGSGGTAG PSEPAPNASV TTDATSLGEV        60
     TLTVWDQEVR GGQEKQMSTL VSQFQQKYPN IKVDRVSRSF DDLTKTLRLA LSGKDAPDVV       120
     QANNTRSQMG AFVTAGELVN LDPWAKAYGW DQRYPASVRA VSSYSPDGKT FGSGSLFGLP       180
     QVGEVVGIYY SRSKLESLGL QPPTTWAELD AALAAAKDKG EVPLVLGNLE KWPAGHVFGV       240
     VQGRYVPADQ IRALGFGQPG GDWTSPENVK AAQTLVDWVD RGYFNSGFNG QDYDPAWQSF       300
     TKGEGVFLIA GSWLQADLSA AMKDDVGFML PPPSEAGGTA VTTGGTGLPF AITDKAVNKD       360
     AAAAYINFIT SPEAMKVLAE NGNLPVVETS QQAAPDALGK DVFAAFDAVS RADGLVPYLD       420
     WATPTMGDTL GATLQDLLAK KLSPADALAR LQEDYSEFTS K                           461
//

If you have problems or comments...

PBIL Back to PBIL home page