(data stored in SCRATCH zone)

EMBL: CP002343.PE404

CP002343.PE404       Location/Qualifiers
FT   CDS             complement(450949..452151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0418"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611: IPR002173; KEGG: art:Arth_2897
FT                   ribokinase-like domain-containing protein; PFAM: PfkB
FT                   domain protein; SPTR: Putative carbohydrate kinase; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46966"
FT                   /db_xref="GOA:E6S862"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6S862"
FT                   /protein_id="ADU46966.1"
FT                   /translation="MDVRTGGSRTSDHVPPRPPRDRPHAARRAGQPGDTDLDVFMSGTV
FT                   FLDIVFTGLEHRPAGGEEVWSTGMGSAPGGIANLAVAASRLGLRTGLAAAFGDDAYGDF
FT                   CWSTLAEQEGVDLSRSRRFPRWHTPVTVSMADATDRGMVTHGHPPPVDLGEMIGEPPRS
FT                   AAAIVDLGPGGGASGPAGTATWVERAHRQGTLVFADLGFDPTGAWDRGVLDRLLHCHAF
FT                   MPNAVEAMAYTRTTTPQEALYAIADLVPLAIVTNGAQGALALDAGTGEEVAVPALRTHA
FT                   LDPTGAGDVFGAALVVGTLGGWPLLERISFASLCAALAVQHFGGSLAAPGWGDIADWWR
FT                   DLRAVAGATAYEQSLLRRFAFLDDVIPIGPIATTRRAEATLAHLSDLPGPPAGTPPGAS
FT                   L"
     MDVRTGGSRT SDHVPPRPPR DRPHAARRAG QPGDTDLDVF MSGTVFLDIV FTGLEHRPAG        60
     GEEVWSTGMG SAPGGIANLA VAASRLGLRT GLAAAFGDDA YGDFCWSTLA EQEGVDLSRS       120
     RRFPRWHTPV TVSMADATDR GMVTHGHPPP VDLGEMIGEP PRSAAAIVDL GPGGGASGPA       180
     GTATWVERAH RQGTLVFADL GFDPTGAWDR GVLDRLLHCH AFMPNAVEAM AYTRTTTPQE       240
     ALYAIADLVP LAIVTNGAQG ALALDAGTGE EVAVPALRTH ALDPTGAGDV FGAALVVGTL       300
     GGWPLLERIS FASLCAALAV QHFGGSLAAP GWGDIADWWR DLRAVAGATA YEQSLLRRFA       360
     FLDDVIPIGP IATTRRAEAT LAHLSDLPGP PAGTPPGASL                             400
//

If you have problems or comments...

PBIL Back to PBIL home page