(data stored in ACNUC7421 zone)

EMBL: CP002343.PE406

CP002343.PE406       Location/Qualifiers
FT   CDS             453823..456300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0420"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="COGs: COG4409 Neuraminidase (sialidase); InterPro
FT                   IPR000421: IPR017909: IPR012680; KEGG: sgr:SGR_6429
FT                   putative neuramidase; PFAM: coagulation factor 5/8 type
FT                   domain protein; Laminin G sub domain 2; SPTR: Sialidase;
FT                   PFAM: F5/8 type C domain; BNR/Asp-box repeat;
FT                   NPCBM-associated, NEW3 domain of alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46968"
FT                   /db_xref="GOA:E6S864"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:E6S864"
FT                   /protein_id="ADU46968.1"
FT                   /translation="MHTRRAALAGLALTVSIPLTVPLSVPVAMAGAAAATAADQTGITR
FT                   TDLDHTGDGYPVYRIPALTKTTDGTLVAAYDGRPSYGDVPNNIALVVRRSTDDGSTWED
FT                   RQVVRYEAGKPGFGDPSLVTDRVTGRIWLFHAASVNQGYFGSTTGTDDADPNVLHADVS
FT                   WSDDDGLTWQHRRLTSEVKDPQWGGLFAASGEGIQIRRGPHQGRLVQQYAIRYQGGNWA
FT                   ASLISDDHGETWRFGDLLGPGMDENKVVELSDGRLMLNSRAPGGYRKVAYSSDGGETWS
FT                   GLHADDELVDPQNNGSIIRYDADAAPSSPDAAKLLFSNTATQSGRRNLTIRQSCDNGET
FT                   WPIRKVVEPGAAEYSTLTPLGDQQFGLLYERGGYQHISFARFGGDWLDGVCAPLTSRTV
FT                   TAGSPGGTAEVEVKVTSQETGAIDGGRVALDLPSGFTAPEVPVAKLSRGATATVRIPVR
FT                   MPEGAVTNAYPYTARFLSDKGSSQSGGSIVVKGGNVVLSDSTERSYDGATITDLTDRVD
FT                   AVKDLTGGAVTVRFSTTARPAVGTLLSLADPISAVRDVIVSLNGGRPYVEVRTATSTYP
FT                   IRLQSSVDVADGKVHELIAASNAGVTSLILDDAVIAQVDGQGFFADVTALTRPHTLNPS
FT                   GKPNLTLGMNRGHFSVNGGPAAPNSRWGFVGTIHSVEVSDDLRTGEELVPAAGLSIASV
FT                   SSEETAGEDGRAANAVDGNPATIWHSKWTGTAAEYPHQITVDLGQAQPLTALRYLRRAV
FT                   GTNGDIADHVVSVSDDNVSWTQVATGTFAATKGEEEVRFAPQTARYVRLEALSAVNGLQ
FT                   FAAAAELRPVRTS"
     MHTRRAALAG LALTVSIPLT VPLSVPVAMA GAAAATAADQ TGITRTDLDH TGDGYPVYRI        60
     PALTKTTDGT LVAAYDGRPS YGDVPNNIAL VVRRSTDDGS TWEDRQVVRY EAGKPGFGDP       120
     SLVTDRVTGR IWLFHAASVN QGYFGSTTGT DDADPNVLHA DVSWSDDDGL TWQHRRLTSE       180
     VKDPQWGGLF AASGEGIQIR RGPHQGRLVQ QYAIRYQGGN WAASLISDDH GETWRFGDLL       240
     GPGMDENKVV ELSDGRLMLN SRAPGGYRKV AYSSDGGETW SGLHADDELV DPQNNGSIIR       300
     YDADAAPSSP DAAKLLFSNT ATQSGRRNLT IRQSCDNGET WPIRKVVEPG AAEYSTLTPL       360
     GDQQFGLLYE RGGYQHISFA RFGGDWLDGV CAPLTSRTVT AGSPGGTAEV EVKVTSQETG       420
     AIDGGRVALD LPSGFTAPEV PVAKLSRGAT ATVRIPVRMP EGAVTNAYPY TARFLSDKGS       480
     SQSGGSIVVK GGNVVLSDST ERSYDGATIT DLTDRVDAVK DLTGGAVTVR FSTTARPAVG       540
     TLLSLADPIS AVRDVIVSLN GGRPYVEVRT ATSTYPIRLQ SSVDVADGKV HELIAASNAG       600
     VTSLILDDAV IAQVDGQGFF ADVTALTRPH TLNPSGKPNL TLGMNRGHFS VNGGPAAPNS       660
     RWGFVGTIHS VEVSDDLRTG EELVPAAGLS IASVSSEETA GEDGRAANAV DGNPATIWHS       720
     KWTGTAAEYP HQITVDLGQA QPLTALRYLR RAVGTNGDIA DHVVSVSDDN VSWTQVATGT       780
     FAATKGEEEV RFAPQTARYV RLEALSAVNG LQFAAAAELR PVRTS                       825
//

If you have problems or comments...

PBIL Back to PBIL home page