(data stored in ACNUC7421 zone)

EMBL: CP002343.PE407

CP002343.PE407       Location/Qualifiers
FT   CDS             complement(456490..457497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0421"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR006132: IPR006131: IPR002292: IPR006130; KEGG:
FT                   sma:SAV_2319 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; SPTR: Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46969"
FT                   /db_xref="GOA:E6S865"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E6S865"
FT                   /protein_id="ADU46969.1"
FT                   /translation="MTVASLFGRNVLKESDLTPDEFRALLDLAADLKAAKRERREQRRL
FT                   AGLNIALLFEKTSTRTRCAFEVAAADQGASTTYLDPAGSQMGHKESIKDTARVLGRYYD
FT                   GIEYRGAGHDVVETLGAWAGVPVWNGLTDDWHPTQSLCDALTMREHAAKPDSEIAFAYV
FT                   GDARFNMGNSLLVMGAMLGMDVRIAAPRSLWPSEAVVAQAKSYAAESGSRVTLTEDVAE
FT                   GIAGVDFVHTDVWVSMGEAKDVWAERIRLLTPYQVNAELLQLTGNRDVRFMHCLPAFHD
FT                   LETKVGRDVHAEFGRKELEVTDDVFESEASIVFDQAENRMHTIKALLVATLARP"
     MTVASLFGRN VLKESDLTPD EFRALLDLAA DLKAAKRERR EQRRLAGLNI ALLFEKTSTR        60
     TRCAFEVAAA DQGASTTYLD PAGSQMGHKE SIKDTARVLG RYYDGIEYRG AGHDVVETLG       120
     AWAGVPVWNG LTDDWHPTQS LCDALTMREH AAKPDSEIAF AYVGDARFNM GNSLLVMGAM       180
     LGMDVRIAAP RSLWPSEAVV AQAKSYAAES GSRVTLTEDV AEGIAGVDFV HTDVWVSMGE       240
     AKDVWAERIR LLTPYQVNAE LLQLTGNRDV RFMHCLPAFH DLETKVGRDV HAEFGRKELE       300
     VTDDVFESEA SIVFDQAENR MHTIKALLVA TLARP                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page