(data stored in ACNUC7421 zone)

EMBL: CP002343.PE409

CP002343.PE409       Location/Qualifiers
FT   CDS             459511..460722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0423"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG0738 Fucose permease; InterPro IPR011701;
FT                   KEGG: sen:SACE_4438 putative DeoR-type transcriptional
FT                   regulator; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   Putative integral membrane protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46971"
FT                   /db_xref="GOA:E6S867"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S867"
FT                   /protein_id="ADU46971.1"
FT                   /translation="MSAIAPSVPVVRTARNAVFTAFAINGAAFAAFASRVPDLKHQLVL
FT                   TAGELGLTLLALSLGAVIGLPLSGWFVHRFGAGRSTLGAAAVQSLGLVGVGLAVTAMES
FT                   RALAMAALVLVGVGTGVFDVSMNLEGAAVERLLGRSIMPHFHAAFSAGTVVSALVGAGL
FT                   SFLHVSVLAHLVGVAVLLLAVTPWFLRAFLPREVEDDPTDETRDPAAGGRGRAGLGAAW
FT                   REPRTLLIGVVVFAAAFTEGTANDWIGVALSDGYDLPRWAGVLGFAVFLTAMTAGRVLG
FT                   TRLLDARGRLPVLRVLFVAAVAGSLLVVFGGPVLAFVGAAVWGVGASLGFPVGMSAAAD
FT                   EPRRAAARMSVVSTIGYTAFIAGPPLLGFLGDHVGVLRSLLVVGAMAGLAVAALPAVRE
FT                   ADRR"
     MSAIAPSVPV VRTARNAVFT AFAINGAAFA AFASRVPDLK HQLVLTAGEL GLTLLALSLG        60
     AVIGLPLSGW FVHRFGAGRS TLGAAAVQSL GLVGVGLAVT AMESRALAMA ALVLVGVGTG       120
     VFDVSMNLEG AAVERLLGRS IMPHFHAAFS AGTVVSALVG AGLSFLHVSV LAHLVGVAVL       180
     LLAVTPWFLR AFLPREVEDD PTDETRDPAA GGRGRAGLGA AWREPRTLLI GVVVFAAAFT       240
     EGTANDWIGV ALSDGYDLPR WAGVLGFAVF LTAMTAGRVL GTRLLDARGR LPVLRVLFVA       300
     AVAGSLLVVF GGPVLAFVGA AVWGVGASLG FPVGMSAAAD EPRRAAARMS VVSTIGYTAF       360
     IAGPPLLGFL GDHVGVLRSL LVVGAMAGLA VAALPAVREA DRR                         403
//

If you have problems or comments...

PBIL Back to PBIL home page