(data stored in ACNUC7421 zone)

EMBL: CP002343.PE41

CP002343.PE41        Location/Qualifiers
FT   CDS             complement(45434..46099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R0144 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46603"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK2"
FT                   /protein_id="ADU46603.1"
FT                   /translation="MDSAELRRRLAQCGRGELPSLVRELVMDRVPYCFAAEQSLFPKVQ
FT                   AHLGAGLKIDPAGVRLVGSGCVGFSVAPDTFPKPFHSGSDLDFAIVSKELFDTAWHGLL
FT                   SWGHPRRHTLPGQENQWFGRRKDEIFWGWIDVKYLHFRGLRFVDDLKPLQKLRAAWFDT
FT                   FQSIGAEFPGTEIAGREVSGRLYRSEEHLIQYQAEGLRKLRYRLAVAREKEASPHGLQ"
     MDSAELRRRL AQCGRGELPS LVRELVMDRV PYCFAAEQSL FPKVQAHLGA GLKIDPAGVR        60
     LVGSGCVGFS VAPDTFPKPF HSGSDLDFAI VSKELFDTAW HGLLSWGHPR RHTLPGQENQ       120
     WFGRRKDEIF WGWIDVKYLH FRGLRFVDDL KPLQKLRAAW FDTFQSIGAE FPGTEIAGRE       180
     VSGRLYRSEE HLIQYQAEGL RKLRYRLAVA REKEASPHGL Q                           221
//

If you have problems or comments...

PBIL Back to PBIL home page