(data stored in ACNUC7421 zone)

EMBL: CP002343.PE412

CP002343.PE412       Location/Qualifiers
FT   CDS             complement(463676..465085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46974"
FT                   /db_xref="GOA:E6S870"
FT                   /db_xref="UniProtKB/TrEMBL:E6S870"
FT                   /protein_id="ADU46974.1"
FT                   /translation="MTGPVDVSALEVDDEDWLGQADWIVGGQAARAARKQGIYAGYVLV
FT                   LFAAVYGFPLVQALFRTSDRIWLREQLASAGGVLVLAGSVAAILGAGLWAGRFRGPVVP
FT                   PLPWIDLVVTAPVDRALAVRRWWRFAVVATVFVGAVVGLVLGSGLAFAEVTGVAAIAVA
FT                   TLAGAALGVLGARLWLWGQVRSWPGADRGVSVLWRVPDALRALHAESLRAHSANTSTLA
FT                   GSALTGNLRTARLAFARPVRRGRTARLRAGRPIRVLVRRDVLGLRRQPATVLAGAGLST
FT                   IGALVLVWGLTQPAAPAVALGVGMLPLYLGFGAWAEGLRLQADNVGTPSLIGVAAVPEA
FT                   VAHLVVPAVLTSGVLGGAAGLAALTTGLPPVALGVLAAVVPSVALLCGGHLLAAFRGAP
FT                   PTVSGPQGVVLWYLRPGLVVVVLGGVTSYALRGGHGVGSVTATLAICLVVAWGLATVRR
FT                   LTHLHRAFGAT"
     MTGPVDVSAL EVDDEDWLGQ ADWIVGGQAA RAARKQGIYA GYVLVLFAAV YGFPLVQALF        60
     RTSDRIWLRE QLASAGGVLV LAGSVAAILG AGLWAGRFRG PVVPPLPWID LVVTAPVDRA       120
     LAVRRWWRFA VVATVFVGAV VGLVLGSGLA FAEVTGVAAI AVATLAGAAL GVLGARLWLW       180
     GQVRSWPGAD RGVSVLWRVP DALRALHAES LRAHSANTST LAGSALTGNL RTARLAFARP       240
     VRRGRTARLR AGRPIRVLVR RDVLGLRRQP ATVLAGAGLS TIGALVLVWG LTQPAAPAVA       300
     LGVGMLPLYL GFGAWAEGLR LQADNVGTPS LIGVAAVPEA VAHLVVPAVL TSGVLGGAAG       360
     LAALTTGLPP VALGVLAAVV PSVALLCGGH LLAAFRGAPP TVSGPQGVVL WYLRPGLVVV       420
     VLGGVTSYAL RGGHGVGSVT ATLAICLVVA WGLATVRRLT HLHRAFGAT                   469
//

If you have problems or comments...

PBIL Back to PBIL home page