(data stored in ACNUC7421 zone)

EMBL: CP002343.PE415

CP002343.PE415       Location/Qualifiers
FT   CDS             468506..469252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0429"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: nca:Noca_2043 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Putative
FT                   methyltransferase, S-Adenosyl-L-methionine (SAM)-MTase
FT                   protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46977"
FT                   /db_xref="GOA:E6S873"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S873"
FT                   /protein_id="ADU46977.1"
FT                   /translation="MAADAYGRFMGRYSEPLAEQFVDWVGVRPGERALDVGSGPGALAA
FT                   RLVDRIGLTAVSAIDPSLPFVSALRARLPGLDVQSAGAERLPFPDDFFDHALAQLVVHF
FT                   MQDPATGIAEMARVTRPGGSVSSCVWDFAGGRAPLSTFWQAVTDLDPGARTEEDLPGAR
FT                   AGDLEGLLEAAGLTEIRSGELVVVVAQRSFEEWWEPYTFGVGPAGEHVASLTDNARDAL
FT                   RDHCRGLLQDAPFDVEATAWAASGTV"
     MAADAYGRFM GRYSEPLAEQ FVDWVGVRPG ERALDVGSGP GALAARLVDR IGLTAVSAID        60
     PSLPFVSALR ARLPGLDVQS AGAERLPFPD DFFDHALAQL VVHFMQDPAT GIAEMARVTR       120
     PGGSVSSCVW DFAGGRAPLS TFWQAVTDLD PGARTEEDLP GARAGDLEGL LEAAGLTEIR       180
     SGELVVVVAQ RSFEEWWEPY TFGVGPAGEH VASLTDNARD ALRDHCRGLL QDAPFDVEAT       240
     AWAASGTV                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page