(data stored in ACNUC7421 zone)

EMBL: CP002343.PE417

CP002343.PE417       Location/Qualifiers
FT   CDS             470037..470636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0431"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro IPR015967: IPR006171: IPR000093:
FT                   IPR006154; KEGG: bcv:Bcav_0549 recombination protein RecR;
FT                   PFAM: TOPRIM domain-containing protein; Zinc finger
FT                   C4-type, RecR; SMART: Toprim sub domain-containing protein;
FT                   SPTR: Recombination protein RecR; TIGRFAM: recombination
FT                   protein RecR; PFAM: Toprim domain; RecR protein; TIGRFAM:
FT                   recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46979"
FT                   /db_xref="GOA:E6S875"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6S875"
FT                   /protein_id="ADU46979.1"
FT                   /translation="MYEGAVQDLIDELGRLPGVGPKGAQRIAFHLLQADSDDVSRLVTA
FT                   LTEVKARVRFCEVCGNVAEAERCRICADSRRDHTAICVVEEPKDIVAIERTREFRGTYH
FT                   VLGGAISPIDGIGPDDLRVRELMQRLASGEVQEVIIATDPNLEGEATATYLSRLLRDVG
FT                   LTVTRLASGLPVGGDLEYADEVTLGRAFEGRRRVDA"
     MYEGAVQDLI DELGRLPGVG PKGAQRIAFH LLQADSDDVS RLVTALTEVK ARVRFCEVCG        60
     NVAEAERCRI CADSRRDHTA ICVVEEPKDI VAIERTREFR GTYHVLGGAI SPIDGIGPDD       120
     LRVRELMQRL ASGEVQEVII ATDPNLEGEA TATYLSRLLR DVGLTVTRLA SGLPVGGDLE       180
     YADEVTLGRA FEGRRRVDA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page