(data stored in SCRATCH zone)

EMBL: CP002343.PE418

CP002343.PE418       Location/Qualifiers
FT   CDS             470718..471368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_0464 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46980"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S876"
FT                   /protein_id="ADU46980.1"
FT                   /translation="MTTDDTTRDDAVPDDVATDSDSDTTAIEDGSAAADELSSLADLTA
FT                   QEASAFLTAITEVASGNSPDTAIPLLTLALSQILVAGARLGAIQDVVLLERYEADPGPD
FT                   DDPDPLRDGLANLLTGIDDYVYVVDPVTSPERVGGSITNDLADIALALTHGLKHYANGR
FT                   TVEALWWWQFSYLSSWGDRALASMRALHSILSHLRLDADDERVAEAEFDALHP"
     MTTDDTTRDD AVPDDVATDS DSDTTAIEDG SAAADELSSL ADLTAQEASA FLTAITEVAS        60
     GNSPDTAIPL LTLALSQILV AGARLGAIQD VVLLERYEAD PGPDDDPDPL RDGLANLLTG       120
     IDDYVYVVDP VTSPERVGGS ITNDLADIAL ALTHGLKHYA NGRTVEALWW WQFSYLSSWG       180
     DRALASMRAL HSILSHLRLD ADDERVAEAE FDALHP                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page