(data stored in ACNUC7421 zone)

EMBL: CP002343.PE419

CP002343.PE419       Location/Qualifiers
FT   CDS             471576..472334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0433"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46981"
FT                   /db_xref="GOA:E6S877"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6S877"
FT                   /protein_id="ADU46981.1"
FT                   /translation="MPSASVSRHQPEPLGPLGPLESPDPPAATDLSRVSEVSGLIVRAR
FT                   RRGDLSQRDLATAVGVSQSTIAALETGDREPALALFLRILAEGGLRLAVVDSSGKEVRP
FT                   VASDTVRDNAGRRLPAHLDADPPDRKPWYRLREERDRVRAGAAQDPRLLPDHPTHAELE
FT                   ARRRQQLYGARPPAPGSDRDAGYLECECETECWLGTACPPQCLCQCETTPRLDPCQGRI
FT                   RVSHDSDAIGGSPTSAIDCELRTPGSREPQ"
     MPSASVSRHQ PEPLGPLGPL ESPDPPAATD LSRVSEVSGL IVRARRRGDL SQRDLATAVG        60
     VSQSTIAALE TGDREPALAL FLRILAEGGL RLAVVDSSGK EVRPVASDTV RDNAGRRLPA       120
     HLDADPPDRK PWYRLREERD RVRAGAAQDP RLLPDHPTHA ELEARRRQQL YGARPPAPGS       180
     DRDAGYLECE CETECWLGTA CPPQCLCQCE TTPRLDPCQG RIRVSHDSDA IGGSPTSAID       240
     CELRTPGSRE PQ                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page