(data stored in ACNUC7421 zone)

EMBL: CP002343.PE42

CP002343.PE42        Location/Qualifiers
FT   CDS             46785..47054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0042"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: rce:RC1_3111 DNA-binding
FT                   protein, putative; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein; SPTR: DNA-binding
FT                   protein, putative; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46604"
FT                   /db_xref="GOA:E6SEK3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK3"
FT                   /protein_id="ADU46604.1"
FT                   /translation="MLTTVRELGAALRDARRASGLSQEALAERAGVSRPWLSRLETAAN
FT                   PGAELRKVLDVLTALGLAVKLGPSPKPAFDDDTDPFADMFGDQT"
     MLTTVRELGA ALRDARRASG LSQEALAERA GVSRPWLSRL ETAANPGAEL RKVLDVLTAL        60
     GLAVKLGPSP KPAFDDDTDP FADMFGDQT                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page