(data stored in ACNUC7421 zone)

EMBL: CP002343.PE420

CP002343.PE420       Location/Qualifiers
FT   CDS             472331..473602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0434"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterProIPR001048:
FT                   IPR002912: IPR018042: IPR005260: IPR 001341; KEGG:
FT                   tcu:Tcur_4886 aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; SPTR: Aspartokinase; TIGRFAM: aspartate
FT                   kinase; aspartate kinase, monofunctional class; PFAM: Amino
FT                   acid kinase family; ACT domain; TIGRFAM: aspartate kinase,
FT                   monofunctional class; aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46982"
FT                   /db_xref="GOA:E6S878"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:E6S878"
FT                   /protein_id="ADU46982.1"
FT                   /translation="MSIVVQKYGGSSVADAESIKRVARRIVETKRQGHQVCVVVSAMGD
FT                   STDELLDLAEQVSAAPPARELDMLLTAGERISMALVAMAIAQLGEEARSFTGSQAGVIT
FT                   DDAHGAARIIDVTPGRIQSALDAGHIAIVAGFQGVSQTTKDITTLGRGGSDTTAVALAA
FT                   ALDADVCEIYTDVDGVFTADPRILPSARKLDVLSMEEMLDLAANGSKILHLRCVEYARR
FT                   YGIPIHVRSSWSQRQGTWIKANPYEGEDAVEAPIIAGIAHDRSEGKITIVGVPDRVGIA
FT                   AKIFGAVADAGINIDMIVQNVSAAETAKTDISFTLPKGDGPKALSVLQAIKGDVEYADL
FT                   RFDDTIGKIALVGAGMKSHPGVSAKFFGALAEAGINIEMISTSEIRVSAVTRAEQLDDA
FT                   VRAVHTAFGLDSTEDAIVYGGTGR"
     MSIVVQKYGG SSVADAESIK RVARRIVETK RQGHQVCVVV SAMGDSTDEL LDLAEQVSAA        60
     PPARELDMLL TAGERISMAL VAMAIAQLGE EARSFTGSQA GVITDDAHGA ARIIDVTPGR       120
     IQSALDAGHI AIVAGFQGVS QTTKDITTLG RGGSDTTAVA LAAALDADVC EIYTDVDGVF       180
     TADPRILPSA RKLDVLSMEE MLDLAANGSK ILHLRCVEYA RRYGIPIHVR SSWSQRQGTW       240
     IKANPYEGED AVEAPIIAGI AHDRSEGKIT IVGVPDRVGI AAKIFGAVAD AGINIDMIVQ       300
     NVSAAETAKT DISFTLPKGD GPKALSVLQA IKGDVEYADL RFDDTIGKIA LVGAGMKSHP       360
     GVSAKFFGAL AEAGINIEMI STSEIRVSAV TRAEQLDDAV RAVHTAFGLD STEDAIVYGG       420
     TGR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page