(data stored in ACNUC7421 zone)

EMBL: CP002343.PE421

CP002343.PE421       Location/Qualifiers
FT   CDS             473687..473953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0435"
FT                   /product="sterile alpha domain containing 1"
FT                   /note="KEGG: hsa:90378 sterile alpha motif domain
FT                   containing 1; SPTR: Atherin"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46983"
FT                   /db_xref="UniProtKB/TrEMBL:E6S879"
FT                   /protein_id="ADU46983.1"
FT                   /translation="MTPDEPKLLPDGRVFPPVTPDPPPPPGQEEIIVPDLDFGSAAEAA
FT                   VGSAAEAAKEPGDEPRDEAPHTAPDTAPDPQDGSEPPAGEPTA"
     MTPDEPKLLP DGRVFPPVTP DPPPPPGQEE IIVPDLDFGS AAEAAVGSAA EAAKEPGDEP        60
     RDEAPHTAPD TAPDPQDGSE PPAGEPTA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page