(data stored in ACNUC7421 zone)

EMBL: CP002343.PE423

CP002343.PE423       Location/Qualifiers
FT   CDS             474502..475191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_6555 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46985"
FT                   /db_xref="GOA:E6S881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S881"
FT                   /protein_id="ADU46985.1"
FT                   /translation="MTGQRQREFLKDNALSLAFLLLLLLSLAGQALSGVAEYNDQARTA
FT                   QLQEISVWRYVTSSRFAVDTAENWQSEYLQFAVFIFLTIWLVQRGSSESKKPGEEGRES
FT                   DKKQLLGRYVRDDSPPWARAGGWRTALYSHSLLVIMTTIFVLSWTAQAIAGRVASNEER
FT                   MRELLEPQTLGQYVTSPDFWSRTFQNWQSEMLAIASMAILSIYLRERGSPESKPVGMPH
FT                   DETSADD"
     MTGQRQREFL KDNALSLAFL LLLLLSLAGQ ALSGVAEYND QARTAQLQEI SVWRYVTSSR        60
     FAVDTAENWQ SEYLQFAVFI FLTIWLVQRG SSESKKPGEE GRESDKKQLL GRYVRDDSPP       120
     WARAGGWRTA LYSHSLLVIM TTIFVLSWTA QAIAGRVASN EERMRELLEP QTLGQYVTSP       180
     DFWSRTFQNW QSEMLAIASM AILSIYLRER GSPESKPVGM PHDETSADD                   229
//

If you have problems or comments...

PBIL Back to PBIL home page