(data stored in ACNUC7421 zone)

EMBL: CP002343.PE424

CP002343.PE424       Location/Qualifiers
FT   CDS             complement(475256..478528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0438"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467: IPR001789: IPR000014: IPR000700: IPR
FT                   005561: IPR013656: IPR003661: IPR003594: IPR013767:
FT                   IPR004358; KEGG: ami:Amir_3954 multi-sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-4 domain protein; response regulator receiver; PAS
FT                   fold domain protein; ANTAR domain protein; SMART: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SPTR:
FT                   Multi-sensor signal transduction histidine kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; Response regulator receiver domain;
FT                   ANTAR domain; His Kinase A (phosphoacceptor) domain; PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46986"
FT                   /db_xref="GOA:E6S8L7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L7"
FT                   /protein_id="ADU46986.1"
FT                   /translation="MTAAPRVPGREIAPDHPGELGARFATIDWSHTPLGPISEWPTELR
FT                   GAVSICLTSRFPMLVWWGPQYVMIYNDGYRPMLGRLKHPAALGSAGKEVWPEIWATIGP
FT                   MLDRVMETGVATWSRDQKLILERNGYPEECYFTFSYSPITSEAGEVGGVFTAVTETTDH
FT                   VLSERRLGTLGVLARRLGEATDAEHVRRLAAEVLLSNPQDHPVVAMVDAAALPDDPRDL
FT                   DVPEELRADVLAAATQAATLQHQVHHDLPSPVHLHDSGLSVAGLHALPIALPGDEELSE
FT                   VLVVGRSSQRTWEPALATYLALCVTHLGTALSAIRTLDTERQRAETLEVLDAAKSSFFT
FT                   NVSHELRTPLTLIAGPVAEALGDPGLTPEQRERLDLVQRNTVRLTRMVDAMLDFGRMAA
FT                   NKLQPLPEPLDVALQTRTMADSFTQAFDRAGLDFVVDCDHAPRTAHLDRDMYERVVLNL
FT                   LSNALKYTPAGSVRLRLECSADGFAVSVADTGIGIRRRDLARIFERFEQLPRRGRARFQ
FT                   GGAGIGLAMVKQLTELMGGSVDVESTLGRGSTFTIRLPWGTPPVESAEPADGRSITPRN
FT                   ADAFLAEAEGWYEPYAAEPAPRTSRPPAVAGSPAGSVPDGAAARPRLLVAEDNRDMRTY
FT                   LRGALESDYDVEMVPDGTTALQRAVASRPDIVLADAMMPGLDGFALTRAIRMNAAVRDV
FT                   PVIILSARAAESDTTEGLTSGADDYVSKPFSVGDLKARLASNLERSRARLRDAAWRRAV
FT                   MESFQDALLITDAEGEVVEVNDAFTQLLGFSADDGPFSVPHPWWPAVQTPTGVAEVDAV
FT                   DVPPTDRANVEQLLAQALQGATITGRECRLVTKDHRDVWVRLSTREVESVGGQPNYVVM
FT                   SLQDVTREHAARARRQAAAALSAEFGRAEDLEQVLEAAVTGFADLFDGDSTVRALAGPE
FT                   EHVFTAAGPVRRADLDDTLWELLTAIEPEVPAPSDRVPGLLISPQNHPSSECRVWVQFR
FT                   RPRRVATDERIVGDLLGQAFALAVDRVVAATAFADRESHLSRAIESHRMIGQAIGILIE
FT                   RHRVTPAEAFTRLKQASQARNIKLREIASRVIETGAEPDEAD"
     MTAAPRVPGR EIAPDHPGEL GARFATIDWS HTPLGPISEW PTELRGAVSI CLTSRFPMLV        60
     WWGPQYVMIY NDGYRPMLGR LKHPAALGSA GKEVWPEIWA TIGPMLDRVM ETGVATWSRD       120
     QKLILERNGY PEECYFTFSY SPITSEAGEV GGVFTAVTET TDHVLSERRL GTLGVLARRL       180
     GEATDAEHVR RLAAEVLLSN PQDHPVVAMV DAAALPDDPR DLDVPEELRA DVLAAATQAA       240
     TLQHQVHHDL PSPVHLHDSG LSVAGLHALP IALPGDEELS EVLVVGRSSQ RTWEPALATY       300
     LALCVTHLGT ALSAIRTLDT ERQRAETLEV LDAAKSSFFT NVSHELRTPL TLIAGPVAEA       360
     LGDPGLTPEQ RERLDLVQRN TVRLTRMVDA MLDFGRMAAN KLQPLPEPLD VALQTRTMAD       420
     SFTQAFDRAG LDFVVDCDHA PRTAHLDRDM YERVVLNLLS NALKYTPAGS VRLRLECSAD       480
     GFAVSVADTG IGIRRRDLAR IFERFEQLPR RGRARFQGGA GIGLAMVKQL TELMGGSVDV       540
     ESTLGRGSTF TIRLPWGTPP VESAEPADGR SITPRNADAF LAEAEGWYEP YAAEPAPRTS       600
     RPPAVAGSPA GSVPDGAAAR PRLLVAEDNR DMRTYLRGAL ESDYDVEMVP DGTTALQRAV       660
     ASRPDIVLAD AMMPGLDGFA LTRAIRMNAA VRDVPVIILS ARAAESDTTE GLTSGADDYV       720
     SKPFSVGDLK ARLASNLERS RARLRDAAWR RAVMESFQDA LLITDAEGEV VEVNDAFTQL       780
     LGFSADDGPF SVPHPWWPAV QTPTGVAEVD AVDVPPTDRA NVEQLLAQAL QGATITGREC       840
     RLVTKDHRDV WVRLSTREVE SVGGQPNYVV MSLQDVTREH AARARRQAAA ALSAEFGRAE       900
     DLEQVLEAAV TGFADLFDGD STVRALAGPE EHVFTAAGPV RRADLDDTLW ELLTAIEPEV       960
     PAPSDRVPGL LISPQNHPSS ECRVWVQFRR PRRVATDERI VGDLLGQAFA LAVDRVVAAT      1020
     AFADRESHLS RAIESHRMIG QAIGILIERH RVTPAEAFTR LKQASQARNI KLREIASRVI      1080
     ETGAEPDEAD                                                             1090
//

If you have problems or comments...

PBIL Back to PBIL home page