(data stored in ACNUC7421 zone)

EMBL: CP002343.PE426

CP002343.PE426       Location/Qualifiers
FT   CDS             479306..480343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0440"
FT                   /product="DNA topoisomerase IB"
FT                   /note="COGs: COG3569 Topoisomerase IB; InterPro IPR001631;
FT                   KEGG: amd:AMED_4291 DNA topoisomerase IB; SPTR: Putative
FT                   uncharacterized protein; PFAM: Eukaryotic DNA topoisomerase
FT                   I, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46988"
FT                   /db_xref="GOA:E6S8L9"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L9"
FT                   /protein_id="ADU46988.1"
FT                   /translation="MRLRRSDPGKPGLRRVRRGKGFVVVDTEGRRVDADTMARVKALVI
FT                   PPAWEDVWVCPWPNGHIQAVGTDAAGRRQYLYHPAWHETRDRVKHERVVTLARRLPEAR
FT                   AEISRRLRRPGLGRERVGAVALRLLDAGLFRTGGEEYETENGSHGVATLRKDHVSVRGD
FT                   VVSFCFPAKSGVEREAEVRDPALAKAVASLKRSRGPSERLLQYRTEGGAWCELTSTEIN
FT                   RDFKELVGDDYTVKDLRTWAGTVLAAAAFAERADHGPPASERVRKKVEREVMTLVSEHL
FT                   GNTPAVARRSYVDSRVPDEYAAGRTIARALARASAADRRRLRRGDLAEVTDRAALERAL
FT                   VRLLS"
     MRLRRSDPGK PGLRRVRRGK GFVVVDTEGR RVDADTMARV KALVIPPAWE DVWVCPWPNG        60
     HIQAVGTDAA GRRQYLYHPA WHETRDRVKH ERVVTLARRL PEARAEISRR LRRPGLGRER       120
     VGAVALRLLD AGLFRTGGEE YETENGSHGV ATLRKDHVSV RGDVVSFCFP AKSGVEREAE       180
     VRDPALAKAV ASLKRSRGPS ERLLQYRTEG GAWCELTSTE INRDFKELVG DDYTVKDLRT       240
     WAGTVLAAAA FAERADHGPP ASERVRKKVE REVMTLVSEH LGNTPAVARR SYVDSRVPDE       300
     YAAGRTIARA LARASAADRR RLRRGDLAEV TDRAALERAL VRLLS                       345
//

If you have problems or comments...

PBIL Back to PBIL home page