(data stored in ACNUC7421 zone)

EMBL: CP002343.PE427

CP002343.PE427       Location/Qualifiers
FT   CDS             480708..482312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0441"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1233 Phytoene dehydrogenase and related
FT                   protein; InterPro IPR002937: IPR006076; KEGG: nml:Namu_3691
FT                   FAD dependent oxidoreductase; PFAM: amine oxidase; FAD
FT                   dependent oxidoreductase; SPTR: FAD dependent
FT                   oxidoreductase; PFAM: Flavin containing amine
FT                   oxidoreductase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46989"
FT                   /db_xref="GOA:E6S8M0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M0"
FT                   /protein_id="ADU46989.1"
FT                   /translation="MVGSGPNGLVAANLLADAGWRVVVLEAQDEPGGAVKSAEDVRPGW
FT                   VHDTFSSFYPLAAASPTIQGLGLERHGLEWVRAPASVGHPLPGGRWAVVHPRPEDTAAA
FT                   LDRLHPGDGEAWLRVCALWDRVGADLVGALLTPFPPLRAGLRLGAKVPRLGGLAFAREL
FT                   LLPVRRLGDEWFGGEGPKLLLAGNAAHADIAMDAPGSGLLGLLLAMLGQSHGFPVPRGG
FT                   AGRLTAALVARFESLGGEIRTGVRVNQVEVRSGRAVGVRLGDGEHIRATRAVVADVSAP
FT                   ALFGGLVPWSQLPDRLRRRMRSFEWDAGTVKIDWALSGPVPWASAPELTPGTVHLADSV
FT                   GDLAIAGAQLASGRVPDRGLVILGQMAATDPTRAPRGSESLWAYLHVPQRRSRADQAHP
FT                   EPVDEPRAELVAHQVEERIEEYAPGFRDRVLDRRVLGPAELERRNENLVGGAVNGGTAA
FT                   IHQQLFWRPVPGWGRPETPVQGLYLASASAHPGGGVHGACGSNAARAALAHDRLERLTA
FT                   RRIRPVGPGPRLGRRQP"
     MVGSGPNGLV AANLLADAGW RVVVLEAQDE PGGAVKSAED VRPGWVHDTF SSFYPLAAAS        60
     PTIQGLGLER HGLEWVRAPA SVGHPLPGGR WAVVHPRPED TAAALDRLHP GDGEAWLRVC       120
     ALWDRVGADL VGALLTPFPP LRAGLRLGAK VPRLGGLAFA RELLLPVRRL GDEWFGGEGP       180
     KLLLAGNAAH ADIAMDAPGS GLLGLLLAML GQSHGFPVPR GGAGRLTAAL VARFESLGGE       240
     IRTGVRVNQV EVRSGRAVGV RLGDGEHIRA TRAVVADVSA PALFGGLVPW SQLPDRLRRR       300
     MRSFEWDAGT VKIDWALSGP VPWASAPELT PGTVHLADSV GDLAIAGAQL ASGRVPDRGL       360
     VILGQMAATD PTRAPRGSES LWAYLHVPQR RSRADQAHPE PVDEPRAELV AHQVEERIEE       420
     YAPGFRDRVL DRRVLGPAEL ERRNENLVGG AVNGGTAAIH QQLFWRPVPG WGRPETPVQG       480
     LYLASASAHP GGGVHGACGS NAARAALAHD RLERLTARRI RPVGPGPRLG RRQP             534
//

If you have problems or comments...

PBIL Back to PBIL home page