(data stored in SCRATCH zone)

EMBL: CP002343.PE429

CP002343.PE429       Location/Qualifiers
FT   CDS             482862..483326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0443"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nda:Ndas_5558 hemerythrin
FT                   HHE cation binding domain protein; PFAM: Hemerythrin HHE
FT                   cation binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding domain protein; PFAM: Hemerythrin HHE cation
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46991"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M2"
FT                   /protein_id="ADU46991.1"
FT                   /translation="MSGVITLIKEDHQKLESVFKKLEKAEPQEIPGLLRQVQELLVPHS
FT                   KAEEKVVYPAIRSTVPDESSDIEDGLEEHHHVEETLEQLLASDPEAPGVDGLIAAMIGE
FT                   VRHHVEEEEEQILPAFGDAASNQQLSDLGEQFTAAKEEELRALKAGSAGA"
     MSGVITLIKE DHQKLESVFK KLEKAEPQEI PGLLRQVQEL LVPHSKAEEK VVYPAIRSTV        60
     PDESSDIEDG LEEHHHVEET LEQLLASDPE APGVDGLIAA MIGEVRHHVE EEEEQILPAF       120
     GDAASNQQLS DLGEQFTAAK EEELRALKAG SAGA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page