(data stored in ACNUC7421 zone)

EMBL: CP002343.PE43

CP002343.PE43        Location/Qualifiers
FT   CDS             47051..48340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0043"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="COGs: COG3550 conserved hypothetical protein;
FT                   InterPro IPR012894: IPR012893: IPR017508; KEGG:
FT                   mva:Mvan_1137 HipA domain-containing protein; PFAM: HipA
FT                   domain protein; SPTR: HipA domain protein; TIGRFAM: HipA
FT                   N-terminal domain protein; PFAM: HipA-like C-terminal
FT                   domain; HipA-like N-terminal domain; TIGRFAM: HipA
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46605"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK4"
FT                   /protein_id="ADU46605.1"
FT                   /translation="MNEMNVFLDGALAGRLEQTTGGSLSFSYDAAYTSRPSPTPLSLSM
FT                   PLSSARHSSRVVTAWLEGLLPDNAAVREEWGRRFQVSARNPFALLRHVGRDAAGGVQVL
FT                   PVDVDPPDAALRTGDVRRLSEEQLCSMLRELTVRDAGWEVGEGSGRWSLAGAQNKVALH
FT                   LLDDGTWGVPNDSTPTTHILKPTASGTRFGDLQVNEFVCLRAAAVLGLRVAHVELVDFG
FT                   GAKTLVSTRYDRRRDRNGTWLRLHQEDLLQAMTYPPSKKYQADKGPSVKNVAALLGSLG
FT                   LADRSPVRERFFDAFAFNTLVGGTDAHAKNYSLLLRGPRVALAPLYDAASYAPYLKPGE
FT                   VVHSSMKVGKAWQVRDVTVEDWVEVATALELAPDYALDRVEHLRTGMAGAVSEAADQAP
FT                   APFAKAARQVATAVAKQRHLRVPRLPRARR"
     MNEMNVFLDG ALAGRLEQTT GGSLSFSYDA AYTSRPSPTP LSLSMPLSSA RHSSRVVTAW        60
     LEGLLPDNAA VREEWGRRFQ VSARNPFALL RHVGRDAAGG VQVLPVDVDP PDAALRTGDV       120
     RRLSEEQLCS MLRELTVRDA GWEVGEGSGR WSLAGAQNKV ALHLLDDGTW GVPNDSTPTT       180
     HILKPTASGT RFGDLQVNEF VCLRAAAVLG LRVAHVELVD FGGAKTLVST RYDRRRDRNG       240
     TWLRLHQEDL LQAMTYPPSK KYQADKGPSV KNVAALLGSL GLADRSPVRE RFFDAFAFNT       300
     LVGGTDAHAK NYSLLLRGPR VALAPLYDAA SYAPYLKPGE VVHSSMKVGK AWQVRDVTVE       360
     DWVEVATALE LAPDYALDRV EHLRTGMAGA VSEAADQAPA PFAKAARQVA TAVAKQRHLR       420
     VPRLPRARR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page