(data stored in ACNUC7421 zone)

EMBL: CP002343.PE433

CP002343.PE433       Location/Qualifiers
FT   CDS             484351..485580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0447"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; KEGG: nca:Noca_1876 natural resistance-associated
FT                   macrophage protein; SPTR: Natural resistance-associated
FT                   macrophage protein; PFAM: Natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46995"
FT                   /db_xref="GOA:E6S8M6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M6"
FT                   /protein_id="ADU46995.1"
FT                   /translation="MKKLFAIALGILTAIGGFVDIGDLVANGLVGARFGMSLAWVVVVG
FT                   IVGICVFAEMSGRVAAVSGRATFDLIRERLGPRVGLLNLAASMAVTLLTYTAEIGGVAL
FT                   ALELATSVNPYLWIPVVGAAVWLVLWRVRFSLLENAFGLAGLALIVFAVALWQLGPDWS
FT                   ALWESASRPALPEGESRAVYFYYAIALFGAAMTPYEVFFFSSGGVEEGWTEKDLGVMRA
FT                   NVFIGFPLGGLLSLAIAATAAVTFLPQGIQVDSLSQIGLPVGLALGKLGLAFLLLGFFA
FT                   ATFGAACETGLSVGYSISQYFGWQWGKFVEPLRAARFHTVVLLSTIIGVGVLLTTVDPI
FT                   MLTEYSIVFSAVALPLTYFPILVVANDRTYMGNHTNGRLANTLGTIYLFIVGVAAVAAI
FT                   PLMVLTRAGQ"
     MKKLFAIALG ILTAIGGFVD IGDLVANGLV GARFGMSLAW VVVVGIVGIC VFAEMSGRVA        60
     AVSGRATFDL IRERLGPRVG LLNLAASMAV TLLTYTAEIG GVALALELAT SVNPYLWIPV       120
     VGAAVWLVLW RVRFSLLENA FGLAGLALIV FAVALWQLGP DWSALWESAS RPALPEGESR       180
     AVYFYYAIAL FGAAMTPYEV FFFSSGGVEE GWTEKDLGVM RANVFIGFPL GGLLSLAIAA       240
     TAAVTFLPQG IQVDSLSQIG LPVGLALGKL GLAFLLLGFF AATFGAACET GLSVGYSISQ       300
     YFGWQWGKFV EPLRAARFHT VVLLSTIIGV GVLLTTVDPI MLTEYSIVFS AVALPLTYFP       360
     ILVVANDRTY MGNHTNGRLA NTLGTIYLFI VGVAAVAAIP LMVLTRAGQ                   409
//

If you have problems or comments...

PBIL Back to PBIL home page