(data stored in SCRATCH zone)

EMBL: CP002343.PE434

CP002343.PE434       Location/Qualifiers
FT   CDS             485582..486397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_3278 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46996"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M7"
FT                   /protein_id="ADU46996.1"
FT                   /translation="MADDHLDLVLRVLDHQILGPDRELVGKVDDLELTPTESGLAVTGV
FT                   VVGPGGLSQRLPGRLGDWVAAVWRRLSSSSDPQPVVVPIVHVADLGSGVVLTGRAATAL
FT                   QRSFGLEQWLRQYVVSRIPGAKGGEEDRAPDSDESPSRDEPLVNLTDPPTRPPGPHTRW
FT                   LSQLLGAPVVDESGRHLGSLIELHCGIGNERWTVTHLQVTRSPLGTELGYHADPDQGPV
FT                   VLQRAFRRLQRHDLLIAVGEVREIDTEPPRVVVETRDDRRHPHHDAAAP"
     MADDHLDLVL RVLDHQILGP DRELVGKVDD LELTPTESGL AVTGVVVGPG GLSQRLPGRL        60
     GDWVAAVWRR LSSSSDPQPV VVPIVHVADL GSGVVLTGRA ATALQRSFGL EQWLRQYVVS       120
     RIPGAKGGEE DRAPDSDESP SRDEPLVNLT DPPTRPPGPH TRWLSQLLGA PVVDESGRHL       180
     GSLIELHCGI GNERWTVTHL QVTRSPLGTE LGYHADPDQG PVVLQRAFRR LQRHDLLIAV       240
     GEVREIDTEP PRVVVETRDD RRHPHHDAAA P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page