(data stored in ACNUC7421 zone)

EMBL: CP002343.PE435

CP002343.PE435       Location/Qualifiers
FT   CDS             486454..487875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0449"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0665 Glycine/D-amino acid oxidase
FT                   (deaminating); InterPro IPR017941: IPR006076; KEGG:
FT                   nda:Ndas_1353 FAD dependent oxidoreductase; PFAM: FAD
FT                   dependent oxidoreductase; Rieske [2Fe-2S] iron-sulphur
FT                   domain; SPTR: FAD dependent oxidoreductase; PFAM: Rieske
FT                   [2Fe-2S] domain; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46997"
FT                   /db_xref="GOA:E6S8M8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M8"
FT                   /protein_id="ADU46997.1"
FT                   /translation="MSTHEGTHGSVWLDDPGRRRQPASPLVGDAEADVVVVGAGITGLT
FT                   TALLAARDGNRVVVLEARRVGDGTTGYTTGKVTAQHSLIYAHLVEWAGADRARQYADAN
FT                   RAGIDLVAQLVEELRIDCSLTRADALVYTTSEDSHKIRAMEDEAVAARRLGLPASLVGE
FT                   SGLPFPITAGVSFTDQLHLHPRRYLDGLADAVVAAGGVIHEQTRVTGVTEERGHVVVEA
FT                   DGGKVTATSAVIATLLPFGLVGGYFARTRPTMSYGLAVRLRGAAPAAMTISVDDPTRST
FT                   RPWPDGGPGGLIVVGGGHEVGADVDTEGRYAELEAWARATFDVAELSHRWSAHDYTTPD
FT                   RVPYIGRPPLHRNVYVATGFGKWGLANGSAAGLAISHLIAGHDTPWLPIFDAGRIEGVR
FT                   SVPTLVGGNVKVAAELVTGELRREAPRCSHMGCRLRWNDAEETWDCHCHGSRFASDGQV
FT                   LAGPAVTPVDVGADG"
     MSTHEGTHGS VWLDDPGRRR QPASPLVGDA EADVVVVGAG ITGLTTALLA ARDGNRVVVL        60
     EARRVGDGTT GYTTGKVTAQ HSLIYAHLVE WAGADRARQY ADANRAGIDL VAQLVEELRI       120
     DCSLTRADAL VYTTSEDSHK IRAMEDEAVA ARRLGLPASL VGESGLPFPI TAGVSFTDQL       180
     HLHPRRYLDG LADAVVAAGG VIHEQTRVTG VTEERGHVVV EADGGKVTAT SAVIATLLPF       240
     GLVGGYFART RPTMSYGLAV RLRGAAPAAM TISVDDPTRS TRPWPDGGPG GLIVVGGGHE       300
     VGADVDTEGR YAELEAWARA TFDVAELSHR WSAHDYTTPD RVPYIGRPPL HRNVYVATGF       360
     GKWGLANGSA AGLAISHLIA GHDTPWLPIF DAGRIEGVRS VPTLVGGNVK VAAELVTGEL       420
     RREAPRCSHM GCRLRWNDAE ETWDCHCHGS RFASDGQVLA GPAVTPVDVG ADG              473
//

If you have problems or comments...

PBIL Back to PBIL home page