(data stored in ACNUC7421 zone)

EMBL: CP002343.PE436

CP002343.PE436       Location/Qualifiers
FT   CDS             487885..489540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0450"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006047:
FT                   IPR006589; KEGG: mrd:Mrad2831_0315 alpha amylase catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase catalytic
FT                   region; PFAM: Alpha amylase, catalytic domain; TIGRFAM:
FT                   trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46998"
FT                   /db_xref="GOA:E6S8M9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M9"
FT                   /protein_id="ADU46998.1"
FT                   /translation="MTARWYRSGVIYSLDVRLFQDSNGDGIGDLAGLTSRLDHLSRLGV
FT                   SILWLNPIHPTPFKDGGYDVADYYDVDPALGNLGDFAEFMAECDERGIRVMLDLVLNHT
FT                   SDEHPWFQAARSDPDSPYRDWYVWSEEEPPDRDQGMVFPGVQESTWSYDETAGAWYHHR
FT                   FYAFQPDLNVLNPQVRSEMKKIVTFWERLGVSGFRLDGAPFLIEKTTAEGGAGRDHGFL
FT                   VELRDRLSWLRGDAVFLAEAHVPNDQLLEFFGDADGAASRVQMLFAFRLNEALMLSLAR
FT                   QAAGAIEDALTGLPPLPRNAAWATFLRNHDEVDLSQLTGEERADVFAAFGPEPDHQLYE
FT                   RGIRRRLAPMLGGDEARLRLAYSLQFTMPGTPVLRYGDEIGMGENLDLPERDAIRTPMQ
FT                   WSGTENGGFSTARQDRLIRPVVDLPPFGFKEVNVTDQRLEPNSLLTWFERMLHTLRECE
FT                   EIGAGTHRIIGGPPPAVLVHVAEGPTGVVMFVHNLGDTPQHLELDDVPLGEQPPVEVFS
FT                   DHPYEGELDPTRLDVAPYGFRWLRLRRSHGPAPG"
     MTARWYRSGV IYSLDVRLFQ DSNGDGIGDL AGLTSRLDHL SRLGVSILWL NPIHPTPFKD        60
     GGYDVADYYD VDPALGNLGD FAEFMAECDE RGIRVMLDLV LNHTSDEHPW FQAARSDPDS       120
     PYRDWYVWSE EEPPDRDQGM VFPGVQESTW SYDETAGAWY HHRFYAFQPD LNVLNPQVRS       180
     EMKKIVTFWE RLGVSGFRLD GAPFLIEKTT AEGGAGRDHG FLVELRDRLS WLRGDAVFLA       240
     EAHVPNDQLL EFFGDADGAA SRVQMLFAFR LNEALMLSLA RQAAGAIEDA LTGLPPLPRN       300
     AAWATFLRNH DEVDLSQLTG EERADVFAAF GPEPDHQLYE RGIRRRLAPM LGGDEARLRL       360
     AYSLQFTMPG TPVLRYGDEI GMGENLDLPE RDAIRTPMQW SGTENGGFST ARQDRLIRPV       420
     VDLPPFGFKE VNVTDQRLEP NSLLTWFERM LHTLRECEEI GAGTHRIIGG PPPAVLVHVA       480
     EGPTGVVMFV HNLGDTPQHL ELDDVPLGEQ PPVEVFSDHP YEGELDPTRL DVAPYGFRWL       540
     RLRRSHGPAP G                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page