(data stored in ACNUC7421 zone)

EMBL: CP002343.PE438

CP002343.PE438       Location/Qualifiers
FT   CDS             complement(492217..492735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa23340 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47000"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N1"
FT                   /protein_id="ADU47000.1"
FT                   /translation="MRAGEGRQRHSSFSGRRQRAAAPAGYKENVDTIATFDEVVELARL
FT                   RAPLYVRHSAGPGPDAEHPALDIEAEVALPGLPASGLTPEPWWTRPDEDWVARRLCSCL
FT                   DHVEQRGPDSDERLWLLTGVVVGSGPSHEPLIGAVEALGWVGPEALETAAEVYRTRFHG
FT                   SGLSEPKPA"
     MRAGEGRQRH SSFSGRRQRA AAPAGYKENV DTIATFDEVV ELARLRAPLY VRHSAGPGPD        60
     AEHPALDIEA EVALPGLPAS GLTPEPWWTR PDEDWVARRL CSCLDHVEQR GPDSDERLWL       120
     LTGVVVGSGP SHEPLIGAVE ALGWVGPEAL ETAAEVYRTR FHGSGLSEPK PA               172
//

If you have problems or comments...

PBIL Back to PBIL home page