(data stored in ACNUC7421 zone)

EMBL: CP002343.PE440

CP002343.PE440       Location/Qualifiers
FT   CDS             complement(496435..498120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0454"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006047:
FT                   IPR006589; KEGG: mgi:Mflv_3723 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase,
FT                   catalytic region; PFAM: Alpha amylase, catalytic domain;
FT                   TIGRFAM: trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47002"
FT                   /db_xref="GOA:E6S8N3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N3"
FT                   /protein_id="ADU47002.1"
FT                   /translation="MRMSQTGDLWWKTAVLYCADVQTFYDSDSDGVGDLRGMTEQIEYL
FT                   ADLGITCLWLMPIYPTPSKDDGYDITDFYGVERRLGTHGDFVELVRTARAHGIRVILDF
FT                   VMNHTSDQHPWFRSARRSTDDPYRDYFVWSPTKPKTNPKDIVFPDQEDSLWELEPKTGE
FT                   YYLHHFYKHQPDLNVVNPAVQEEIARTIGFWLELGVSGFRVDAVPFLMTPDTVPADHHQ
FT                   VSFDPKRYLADVRKYVTRRVGDALLLGEVNLPYKDQKTYFGGADGDGLNMQFDFAAMQA
FT                   LYLALAREDARPIEGALRRRPALDVTSQWANFVRNHDELTLDQLTDEERQDVFDAFGPD
FT                   PGMQLFGRGLRRRLPSMLGGDGRRLRLVYSIMFSLPGTPVLFYGEEIGMAENLDVPGRL
FT                   SVRTPMQWGDDPSGGFSDAPPRKLTRPMPDGLYSAERVNVASQRHDHDSLWWFIRTLIR
FT                   LRRQYPQIGWSTVEVPRTKPRSVLAHLAREEDGWTMLALHNLAPESTLVDVSLGEVPPG
FT                   SVLVDLLGDRREHPVAADGSIELEVEGYGYRWLLLHRPGDRPPK"
     MRMSQTGDLW WKTAVLYCAD VQTFYDSDSD GVGDLRGMTE QIEYLADLGI TCLWLMPIYP        60
     TPSKDDGYDI TDFYGVERRL GTHGDFVELV RTARAHGIRV ILDFVMNHTS DQHPWFRSAR       120
     RSTDDPYRDY FVWSPTKPKT NPKDIVFPDQ EDSLWELEPK TGEYYLHHFY KHQPDLNVVN       180
     PAVQEEIART IGFWLELGVS GFRVDAVPFL MTPDTVPADH HQVSFDPKRY LADVRKYVTR       240
     RVGDALLLGE VNLPYKDQKT YFGGADGDGL NMQFDFAAMQ ALYLALARED ARPIEGALRR       300
     RPALDVTSQW ANFVRNHDEL TLDQLTDEER QDVFDAFGPD PGMQLFGRGL RRRLPSMLGG       360
     DGRRLRLVYS IMFSLPGTPV LFYGEEIGMA ENLDVPGRLS VRTPMQWGDD PSGGFSDAPP       420
     RKLTRPMPDG LYSAERVNVA SQRHDHDSLW WFIRTLIRLR RQYPQIGWST VEVPRTKPRS       480
     VLAHLAREED GWTMLALHNL APESTLVDVS LGEVPPGSVL VDLLGDRREH PVAADGSIEL       540
     EVEGYGYRWL LLHRPGDRPP K                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page