(data stored in ACNUC7421 zone)

EMBL: CP002343.PE441

CP002343.PE441       Location/Qualifiers
FT   CDS             498267..499253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0455"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="COGs: COG2141 Coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase; InterPro
FT                   IPR019945; KEGG: mgi:Mflv_3722 putative dehydrogenase
FT                   protein; SPTR: Putative dehydrogenase protein; TIGRFAM:
FT                   F420-dependent oxidoreductase, G6PDH family; PFAM:
FT                   Luciferase-like monooxygenase; TIGRFAM: F420-dependent
FT                   oxidoreductase, G6PDH family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47003"
FT                   /db_xref="GOA:E6S8N4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR023907"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N4"
FT                   /protein_id="ADU47003.1"
FT                   /translation="MPTIGFHCSHEQIPPSQLLEDVRHAEAAGFTAAMCSDHLEPWSTD
FT                   QGQSGYAWSWLGAALNATRLPFGVVTAPGQRYHPAITAQAIGTLGEMFPGRFWAALGSG
FT                   EAVNEHVTGDGWPRKELRDQRLVECAEVIRRLLDGERVSHDGLVTVDRAKVWSRPSTPP
FT                   DLVAAAVSVETAGSAAAWADGLITVNQQEGGDRRAAEAYREHGGRGPARLQLHVSWAPS
FT                   EDEALDIAMQQWRSNVFGSPVAWDTDSVDAFDELGRHVTEDDVRRSVHVSADLESHAAR
FT                   IGQAFDDGFDAVMVHFVGTDQAPFIDAFAAAVLPQFTPAALTGRSTS"
     MPTIGFHCSH EQIPPSQLLE DVRHAEAAGF TAAMCSDHLE PWSTDQGQSG YAWSWLGAAL        60
     NATRLPFGVV TAPGQRYHPA ITAQAIGTLG EMFPGRFWAA LGSGEAVNEH VTGDGWPRKE       120
     LRDQRLVECA EVIRRLLDGE RVSHDGLVTV DRAKVWSRPS TPPDLVAAAV SVETAGSAAA       180
     WADGLITVNQ QEGGDRRAAE AYREHGGRGP ARLQLHVSWA PSEDEALDIA MQQWRSNVFG       240
     SPVAWDTDSV DAFDELGRHV TEDDVRRSVH VSADLESHAA RIGQAFDDGF DAVMVHFVGT       300
     DQAPFIDAFA AAVLPQFTPA ALTGRSTS                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page