(data stored in SCRATCH zone)

EMBL: CP002343.PE443

CP002343.PE443       Location/Qualifiers
FT   CDS             500312..501436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0457"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="COGs: COG2170 conserved hypothetical protein;
FT                   InterPro IPR006336: IPR011793; KEGG: sgr:SGR_459
FT                   carboxylate-amine ligase; PFAM: glutamate--cysteine ligase
FT                   GCS2; SPTR: Carboxylate-amine ligase SACT1DRAFT_0179; PFAM:
FT                   Glutamate-cysteine ligase family 2(GCS2); TIGRFAM:
FT                   uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47005"
FT                   /db_xref="GOA:E6S8N6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N6"
FT                   /protein_id="ADU47005.1"
FT                   /translation="MVRTVGVEEEMLLVDVRNGRPKSVSGQLVLRAAMQQQAVAGLGVH
FT                   GALEGEFQQQMIETHTAPVESLEDLEREVRHWRTEANSAARQVGSSVAALATSPLPVTP
FT                   IPVESTRYAWMHDRYQIVAKQHLTCGLHVHVAIGSDEEGVGVLDRIRVWLPVLLALSGN
FT                   SPFWNGEATGFASWRSQSFGRWPSNGPTEIFGSAAAYHRMVRDMTMSSVILDEGMVYFD
FT                   ARLSQHYPTVEIRVADVCLRASDAVLLAALCRGLVETAARDWARSVPVPDVPTTMVRLA
FT                   TWQAAREGTEGRLLDPFTSRPRLAWDVVDRLVEYVAPALSEAGDVELVKEGLERIRTRG
FT                   NGAQLQTRTMERTGQLIDVVAHAVRVTAGQEEDD"
     MVRTVGVEEE MLLVDVRNGR PKSVSGQLVL RAAMQQQAVA GLGVHGALEG EFQQQMIETH        60
     TAPVESLEDL EREVRHWRTE ANSAARQVGS SVAALATSPL PVTPIPVEST RYAWMHDRYQ       120
     IVAKQHLTCG LHVHVAIGSD EEGVGVLDRI RVWLPVLLAL SGNSPFWNGE ATGFASWRSQ       180
     SFGRWPSNGP TEIFGSAAAY HRMVRDMTMS SVILDEGMVY FDARLSQHYP TVEIRVADVC       240
     LRASDAVLLA ALCRGLVETA ARDWARSVPV PDVPTTMVRL ATWQAAREGT EGRLLDPFTS       300
     RPRLAWDVVD RLVEYVAPAL SEAGDVELVK EGLERIRTRG NGAQLQTRTM ERTGQLIDVV       360
     AHAVRVTAGQ EEDD                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page