(data stored in ACNUC7421 zone)

EMBL: CP002343.PE445

CP002343.PE445       Location/Qualifiers
FT   CDS             complement(501758..502129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47007"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N8"
FT                   /protein_id="ADU47007.1"
FT                   /translation="MSVTSFQDLPLADRDREWDGDAAERRVREWAGAEDGPNEKYRDAH
FT                   VWYDAENKNNFTAYKLLIADVVDGRLKAVPRGVMAAAAVMQGSRGGVDLPDKDRDRVRS
FT                   HLAKYYAKWDDEPPWERDG"
     MSVTSFQDLP LADRDREWDG DAAERRVREW AGAEDGPNEK YRDAHVWYDA ENKNNFTAYK        60
     LLIADVVDGR LKAVPRGVMA AAAVMQGSRG GVDLPDKDRD RVRSHLAKYY AKWDDEPPWE       120
     RDG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page