(data stored in ACNUC7421 zone)

EMBL: CP002343.PE446

CP002343.PE446       Location/Qualifiers
FT   CDS             502378..503226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0460"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit; InterProIPR007627: IPR007624:
FT                   IPR007630: IPR000943: IPR 014322: IPR014284; KEGG:
FT                   nca:Noca_1393 sigma-70 region 4 domain-containing protein;
FT                   PFAM: sigma-70 region 2 domain protein; sigma-70 region 3
FT                   domain protein; sigma-70 region 4 domain protein; SPTR:
FT                   Sigma-70 region 4 domain protein; TIGRFAM: RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 3; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47008"
FT                   /db_xref="GOA:E6S8N9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N9"
FT                   /protein_id="ADU47008.1"
FT                   /translation="MSRMKSVSPTSTPTPISRRRGRFVERDRKAEELLLELSRTTNCAE
FT                   RERLTDEIVRLHLDLCDGVAARYAGRSIPTEDLVQVARLALLVAIKRYQPGPGSSFIGY
FT                   ALPTISGELKRHFRDHGWMVRPPRRLQELGPVLRLAREHWEQEHGTSPTTQDLAEEVGV
FT                   DPEQVSECLSAEHSYHPLSLDLTFGDDESRSLAESLAEPQDELESAADRVSLGTALSSL
FT                   SQKDRELLQMRFVDGMTQKEIGLALGVSQMQVSRLVRAVLDRLRTQMGVTVDDDRSATA
FT                   A"
     MSRMKSVSPT STPTPISRRR GRFVERDRKA EELLLELSRT TNCAERERLT DEIVRLHLDL        60
     CDGVAARYAG RSIPTEDLVQ VARLALLVAI KRYQPGPGSS FIGYALPTIS GELKRHFRDH       120
     GWMVRPPRRL QELGPVLRLA REHWEQEHGT SPTTQDLAEE VGVDPEQVSE CLSAEHSYHP       180
     LSLDLTFGDD ESRSLAESLA EPQDELESAA DRVSLGTALS SLSQKDRELL QMRFVDGMTQ       240
     KEIGLALGVS QMQVSRLVRA VLDRLRTQMG VTVDDDRSAT AA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page