(data stored in ACNUC7421 zone)

EMBL: CP002343.PE448

CP002343.PE448       Location/Qualifiers
FT   CDS             504793..505080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0462"
FT                   /product="Domain of unknown function DUF1905"
FT                   /note="InterPro IPR015018; KEGG: bcv:Bcav_4116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1905; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF1905)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47010"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P1"
FT                   /protein_id="ADU47010.1"
FT                   /translation="MDLEFSGEIVWWRGPAPYHFVRVPDGESAQIEAVKHLVTYGWGVI
FT                   PVTAVVGDTEFTTSLFPKDGAFLVPLKDGVRQAESLELGEVVSIRLILDV"
     MDLEFSGEIV WWRGPAPYHF VRVPDGESAQ IEAVKHLVTY GWGVIPVTAV VGDTEFTTSL        60
     FPKDGAFLVP LKDGVRQAES LELGEVVSIR LILDV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page