(data stored in ACNUC7421 zone)

EMBL: CP002343.PE45

CP002343.PE45        Location/Qualifiers
FT   CDS             50318..50779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0045"
FT                   /product="DoxX family protein"
FT                   /note="COGs: COG2259 membrane protein; InterPro IPR011637;
FT                   KEGG: kfl:Kfla_3391 DoxX family protein; PFAM: DoxX family
FT                   protein; SPTR: DoxX family protein; PFAM: DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46607"
FT                   /db_xref="GOA:E6SEK6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK6"
FT                   /protein_id="ADU46607.1"
FT                   /translation="MTSLLKPLAARDAVLLVARVLLGAIFLAHGWQKLTEWGLDGTGAA
FT                   FDQMGVPLPGIAATLAALIELVGGIALILGALTTVFSVLLVLDMVGAAVLVHIGNGVFI
FT                   TENGWELVAALGAGVLLLAATGAGAYSVDRMLSPRPQARVADRERALVY"
     MTSLLKPLAA RDAVLLVARV LLGAIFLAHG WQKLTEWGLD GTGAAFDQMG VPLPGIAATL        60
     AALIELVGGI ALILGALTTV FSVLLVLDMV GAAVLVHIGN GVFITENGWE LVAALGAGVL       120
     LLAATGAGAY SVDRMLSPRP QARVADRERA LVY                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page