(data stored in ACNUC7421 zone)

EMBL: CP002343.PE453

CP002343.PE453       Location/Qualifiers
FT   CDS             510091..510546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0468"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="COGs: COG1610 conserved hypothetical protein;
FT                   InterPro IPR019004; KEGG: ami:Amir_0234 GatB/YqeY domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Yqey-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47015"
FT                   /db_xref="GOA:E6S8P6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P6"
FT                   /protein_id="ADU47015.1"
FT                   /translation="MSTLKDQLKADLTAAMRSRDQVRAGTIRMALTAVTTEEVAGTQHR
FT                   ELTDDDVLKVLAKEAKKRREAAEAYTTAGRTELADTEQAELAVLEGYLPKQLDESELEA
FT                   IVREAVAGSGASGMQQMGLAMKAANAAVAGRAEGGRVAAIVRRVLAG"
     MSTLKDQLKA DLTAAMRSRD QVRAGTIRMA LTAVTTEEVA GTQHRELTDD DVLKVLAKEA        60
     KKRREAAEAY TTAGRTELAD TEQAELAVLE GYLPKQLDES ELEAIVREAV AGSGASGMQQ       120
     MGLAMKAANA AVAGRAEGGR VAAIVRRVLA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page