(data stored in SCRATCH zone)

EMBL: CP002343.PE454

CP002343.PE454       Location/Qualifiers
FT   CDS             complement(510623..513058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0469"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR001264:
FT                   IPR001460; KEGG: kse:Ksed_25450 membrane carboxypeptidase
FT                   (penicillin-binding protein); PFAM: glycosyl transferase
FT                   family 51; penicillin-binding protein transpeptidase;
FT                   PRIAM: Peptidoglycan glycosyltransferase; SPTR: Putative
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain; Transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47016"
FT                   /db_xref="GOA:E6S8P7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P7"
FT                   /protein_id="ADU47016.1"
FT                   /translation="MSSSRTTSIGGVISLLGAFLAAALVLGLLAAGLFMPAVGATGAIA
FT                   RSGVDIFNELPGEFKTDPLSQQSRILAADGRVIATPAEQNRIIVPLKNVAPIMREAQVA
FT                   IEDHRFYDHGGFDLQGVVRAAIANLRTGQTTSGASSLTQQYVKISLQYSALNQGDKAAA
FT                   QAAVRKDYMRKLKELKYAITLEKKMTKDEILQGYLNLVYYGDQAYGVEAASRHYFSIPA
FT                   SKLSLSQAALLAGLTQNPGTTDPVNYPERALARRNVVLDRMHELGRISDKEWTDAKKRT
FT                   LKQDLKVSQPKSTCLASPYPYWCEFVINYVETMPELGKTVEARRRLLRTGGITVQTTLD
FT                   PKIQRIVQEEVTRKVPIGDPSGVGAAAYVTEPGTGRVLAFAQNTKYTVGKQSRGKTGVS
FT                   WALDKRWGGSGGFQFGSTAKAFSLLTAMESGMSTKASVKAKAAGDKPATYQPSEFAKGC
FT                   GPGTEWKVLNDTPFKGGSISLMKATALSTNTAFVALAQQLGGCKVWDTMNRLGLRTASG
FT                   QPVPKYAPAYILGAAEVSPQGVAHAYATLAADGKKCSMVVVTKVTQGSKTLAAPKTKCD
FT                   QVAKADYVRGTDKFLEYNMTNGSGVRNQLDGRESAGKTGTSDKNNESWFVGYTPNLVTS
FT                   VWVGTPDDGNKRLMKNVRVGGQFYPVMHGASIAAPIWKGIMNRALEGEPVLRFKEPSDK
FT                   VLNGELVDIPSVTGRTVADATKILEEAGFHRRRRRLDGVEHPQGPRRRHVTVRPGTPGQ
FT                   RRHDLHVRGPEPADEQGQARSEADHHDRAAPRPEADEATAPQAQLHGDRGPAQRLRAG"
     MSSSRTTSIG GVISLLGAFL AAALVLGLLA AGLFMPAVGA TGAIARSGVD IFNELPGEFK        60
     TDPLSQQSRI LAADGRVIAT PAEQNRIIVP LKNVAPIMRE AQVAIEDHRF YDHGGFDLQG       120
     VVRAAIANLR TGQTTSGASS LTQQYVKISL QYSALNQGDK AAAQAAVRKD YMRKLKELKY       180
     AITLEKKMTK DEILQGYLNL VYYGDQAYGV EAASRHYFSI PASKLSLSQA ALLAGLTQNP       240
     GTTDPVNYPE RALARRNVVL DRMHELGRIS DKEWTDAKKR TLKQDLKVSQ PKSTCLASPY       300
     PYWCEFVINY VETMPELGKT VEARRRLLRT GGITVQTTLD PKIQRIVQEE VTRKVPIGDP       360
     SGVGAAAYVT EPGTGRVLAF AQNTKYTVGK QSRGKTGVSW ALDKRWGGSG GFQFGSTAKA       420
     FSLLTAMESG MSTKASVKAK AAGDKPATYQ PSEFAKGCGP GTEWKVLNDT PFKGGSISLM       480
     KATALSTNTA FVALAQQLGG CKVWDTMNRL GLRTASGQPV PKYAPAYILG AAEVSPQGVA       540
     HAYATLAADG KKCSMVVVTK VTQGSKTLAA PKTKCDQVAK ADYVRGTDKF LEYNMTNGSG       600
     VRNQLDGRES AGKTGTSDKN NESWFVGYTP NLVTSVWVGT PDDGNKRLMK NVRVGGQFYP       660
     VMHGASIAAP IWKGIMNRAL EGEPVLRFKE PSDKVLNGEL VDIPSVTGRT VADATKILEE       720
     AGFHRRRRRL DGVEHPQGPR RRHVTVRPGT PGQRRHDLHV RGPEPADEQG QARSEADHHD       780
     RAAPRPEADE ATAPQAQLHG DRGPAQRLRA G                                      811
//

If you have problems or comments...

PBIL Back to PBIL home page