(data stored in SCRATCH zone)

EMBL: CP002343.PE456

CP002343.PE456       Location/Qualifiers
FT   CDS             complement(513714..514934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0471"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; KEGG: tbi:Tbis_0197 anion-transporting
FT                   ATPase; SPTR: Putative ion-transporting ATPase; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47018"
FT                   /db_xref="GOA:E6S8P9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P9"
FT                   /protein_id="ADU47018.1"
FT                   /translation="MTQTPHTPAHPPAHSPAHVRAAQAAPRLDIDAMIADRSVEVVVCC
FT                   GAGGVGKTTTAAALGLRAAEAGRRVVVLTIDPARRLAQALGLSELDNTPRPVVGFDASA
FT                   GGSLDAMMLDMKRTFDEVVLAHADPGKAEQILANPFYQAVSSSFAGTQEYMAMEKLGQL
FT                   KAAAGSSPDGWDLIIVDTPPSRSALDFLDAPNRLGSFLDGRFIRLLSAPAKASGRAGVK
FT                   VFGLGVQLVSSTMTKILGGQFLTDVQTFVAALDTMFGGFRERADETYRLLSRAGTSFLV
FT                   VAAPERDALREASYFVDRLQADRMPLSGLVVNRMGRVSAGALTPSRALSVAEALEDRGG
FT                   PKSAENAAGLLRLHAAVVTIAQRQRELAERFSRSHPDVPVRQIPALNRDVHDLESLREI
FT                   GNALAGP"
     MTQTPHTPAH PPAHSPAHVR AAQAAPRLDI DAMIADRSVE VVVCCGAGGV GKTTTAAALG        60
     LRAAEAGRRV VVLTIDPARR LAQALGLSEL DNTPRPVVGF DASAGGSLDA MMLDMKRTFD       120
     EVVLAHADPG KAEQILANPF YQAVSSSFAG TQEYMAMEKL GQLKAAAGSS PDGWDLIIVD       180
     TPPSRSALDF LDAPNRLGSF LDGRFIRLLS APAKASGRAG VKVFGLGVQL VSSTMTKILG       240
     GQFLTDVQTF VAALDTMFGG FRERADETYR LLSRAGTSFL VVAAPERDAL REASYFVDRL       300
     QADRMPLSGL VVNRMGRVSA GALTPSRALS VAEALEDRGG PKSAENAAGL LRLHAAVVTI       360
     AQRQRELAER FSRSHPDVPV RQIPALNRDV HDLESLREIG NALAGP                      406
//

If you have problems or comments...

PBIL Back to PBIL home page