(data stored in ACNUC7421 zone)

EMBL: CP002343.PE46

CP002343.PE46        Location/Qualifiers
FT   CDS             50983..51915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_1866 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46608"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK7"
FT                   /protein_id="ADU46608.1"
FT                   /translation="MSARAVWPELPVASWEPTRDTLTLWLQVIGKIRIARTPLLNHWWN
FT                   APLYVTTRGLTTSPIPGDAGRSLAIDLDLLDHRLDVTTTRGERRSMALEPKSVKDFHAE
FT                   LHGLLGGVGLATEIWPVPVELPEAIRFDEDTTHHDYDPEAVTAFWRTLVEVQRVFEVFR
FT                   SRFLGKSSPVHLFWGALDLATTRFSGKGAPPHPGGMPNCGPHVMHEAYSHEVSSCGYWP
FT                   GAEGEGIFYAYAYPDPDGYRDLPPGPAGARWDDELGEFVLPYTAVRTAQDPDAVLLDFL
FT                   QSTYAAAATTAGWDRAALERPALERPARA"
     MSARAVWPEL PVASWEPTRD TLTLWLQVIG KIRIARTPLL NHWWNAPLYV TTRGLTTSPI        60
     PGDAGRSLAI DLDLLDHRLD VTTTRGERRS MALEPKSVKD FHAELHGLLG GVGLATEIWP       120
     VPVELPEAIR FDEDTTHHDY DPEAVTAFWR TLVEVQRVFE VFRSRFLGKS SPVHLFWGAL       180
     DLATTRFSGK GAPPHPGGMP NCGPHVMHEA YSHEVSSCGY WPGAEGEGIF YAYAYPDPDG       240
     YRDLPPGPAG ARWDDELGEF VLPYTAVRTA QDPDAVLLDF LQSTYAAAAT TAGWDRAALE       300
     RPALERPARA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page