(data stored in ACNUC7421 zone)

EMBL: CP002343.PE460

CP002343.PE460       Location/Qualifiers
FT   CDS             517757..517915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_0333 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47022"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q3"
FT                   /protein_id="ADU47022.1"
FT                   /translation="MTTWEYLTAPLLIHNTKQILDNFGADGWELVQVVPGPDGTSLVAY
FT                   FKRPKGA"
     MTTWEYLTAP LLIHNTKQIL DNFGADGWEL VQVVPGPDGT SLVAYFKRPK GA                52
//

If you have problems or comments...

PBIL Back to PBIL home page