(data stored in ACNUC7421 zone)

EMBL: CP002343.PE464

CP002343.PE464       Location/Qualifiers
FT   CDS             complement(520222..520884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0479"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595: IPR012318: IPR001808:
FT                   IPR002373; KEGG: nca:Noca_0339 cyclic nucleotide-binding;
FT                   PFAM: cyclic nucleotide-binding; regulatory protein Crp;
FT                   SMART: cyclic nucleotide-binding; regulatory protein Crp;
FT                   SPTR: Putative transcriptional regulator with cyclic
FT                   nucleotide-binding domain protein; PFAM: Bacterial
FT                   regulatory proteins, crp family; Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47026"
FT                   /db_xref="GOA:E6S8Q7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q7"
FT                   /protein_id="ADU47026.1"
FT                   /translation="MRRAPLFKALDDEAAAALQSQMTLSRMERGDVLFHEGDRGDTLYV
FT                   IAEGKVKLGRTSADGRENLVAILGPGEMFGELSLFDPGPRTMTATAVAETQLLGLGNDS
FT                   LTGLLTGRPEVAKSLLAALAQRLRRTNAHLADLVFTDVPGRVAKALIDLSERFGRHVEG
FT                   GLLVAHDLTQEELAQLVGASRETVNKALADFQSRGWLRLEARAVLLQDVERLRRRAK"
     MRRAPLFKAL DDEAAAALQS QMTLSRMERG DVLFHEGDRG DTLYVIAEGK VKLGRTSADG        60
     RENLVAILGP GEMFGELSLF DPGPRTMTAT AVAETQLLGL GNDSLTGLLT GRPEVAKSLL       120
     AALAQRLRRT NAHLADLVFT DVPGRVAKAL IDLSERFGRH VEGGLLVAHD LTQEELAQLV       180
     GASRETVNKA LADFQSRGWL RLEARAVLLQ DVERLRRRAK                             220
//

If you have problems or comments...

PBIL Back to PBIL home page