(data stored in ACNUC7421 zone)

EMBL: CP002343.PE465

CP002343.PE465       Location/Qualifiers
FT   CDS             521062..521796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0480"
FT                   /product="endonuclease III; DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease;
FT                   InterProIPR003265: IPR003651: IPR004035: IPR004036: IPR
FT                   005759; KEGG: kfl:Kfla_0455 endonuclease III; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; PRIAM:
FT                   DNA-(apurinic or apyrimidinic site) lyase; SMART: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SPTR: Putative
FT                   endonuclease III; TIGRFAM: endonuclease III; manually
FT                   curated; PFAM: HhH-GPD superfamily base excision DNA repair
FT                   protein; Iron-sulfur binding domain of endonuclease III;
FT                   Helix-hairpin-helix motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47027"
FT                   /db_xref="GOA:E6S8Q8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q8"
FT                   /protein_id="ADU47027.1"
FT                   /translation="MSSVSARAVVTADESPVARTRRARAMYRALHDRYPYAHCELDFTT
FT                   PLELLVATILSAQTTDVGVNKVTPIVFAKYRTAADYAAADRTELETIIQPTGFFRAKSD
FT                   SLIKLGQALVERFDGEVPGRLKDLVTLPGVGRKTANVVLGNAFNVPGITVDTHFGRLVR
FT                   RFGWTAEEDPVKVEHAVGALFLRRDWTMLSHVVIFHGRRTCHAKKPACGACPVARWCPS
FT                   YGIGETDPERAARLLKFELAPK"
     MSSVSARAVV TADESPVART RRARAMYRAL HDRYPYAHCE LDFTTPLELL VATILSAQTT        60
     DVGVNKVTPI VFAKYRTAAD YAAADRTELE TIIQPTGFFR AKSDSLIKLG QALVERFDGE       120
     VPGRLKDLVT LPGVGRKTAN VVLGNAFNVP GITVDTHFGR LVRRFGWTAE EDPVKVEHAV       180
     GALFLRRDWT MLSHVVIFHG RRTCHAKKPA CGACPVARWC PSYGIGETDP ERAARLLKFE       240
     LAPK                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page