(data stored in SCRATCH zone)

EMBL: CP002343.PE466

CP002343.PE466       Location/Qualifiers
FT   CDS             521793..522539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0481"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086; KEGG: sgr:SGR_3331 hypothetical
FT                   protein; PFAM: NUDIX hydrolase; SPTR: NUDIX hydrolase;
FT                   PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47028"
FT                   /db_xref="GOA:E6S8Q9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q9"
FT                   /protein_id="ADU47028.1"
FT                   /translation="MTAPLTPAPRGARVVHSGATGAIPPGPAGLPRPRWLDEVAERVPS
FT                   VDAHWFSRFQPPEEGGRESAVLMLFGPPPAGEPSEGEHVILIERSHTMRTQPAQIAFPG
FT                   GSRDPEDEDSVHTALREAEEETGIVPAGVDVVDVLPSLYLPPANFVVAPVLGWWAEPAP
FT                   LTVRDPAEVQEVLSVPISHLIHPETRFTVTHPSGYVGPAFELDHLLLWGFTAGLLSRVL
FT                   DLAGLAVEWDEARRRPLPEIYLRDRR"
     MTAPLTPAPR GARVVHSGAT GAIPPGPAGL PRPRWLDEVA ERVPSVDAHW FSRFQPPEEG        60
     GRESAVLMLF GPPPAGEPSE GEHVILIERS HTMRTQPAQI AFPGGSRDPE DEDSVHTALR       120
     EAEEETGIVP AGVDVVDVLP SLYLPPANFV VAPVLGWWAE PAPLTVRDPA EVQEVLSVPI       180
     SHLIHPETRF TVTHPSGYVG PAFELDHLLL WGFTAGLLSR VLDLAGLAVE WDEARRRPLP       240
     EIYLRDRR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page