(data stored in ACNUC7421 zone)

EMBL: CP002343.PE468

CP002343.PE468       Location/Qualifiers
FT   CDS             complement(523890..524282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0483"
FT                   /product="UspA domain-containing protein"
FT                   /note="InterPro IPR006016: IPR006015; KEGG: aau:AAur_0701
FT                   universal stress family domain-containing protein; PFAM:
FT                   UspA domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Universal stress protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47030"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R1"
FT                   /protein_id="ADU47030.1"
FT                   /translation="MTIVVGYIPTTQGEAAITAAITEARAHGDSLLVVNMSRDDKLVDA
FT                   HRAASTELSRLDAELTESGVPHEVRRVEHGTDPADAILRIIGEVDARMLVIGLRPRTPV
FT                   GKLLLGSTAQRLLLDADCPVLAVKAH"
     MTIVVGYIPT TQGEAAITAA ITEARAHGDS LLVVNMSRDD KLVDAHRAAS TELSRLDAEL        60
     TESGVPHEVR RVEHGTDPAD AILRIIGEVD ARMLVIGLRP RTPVGKLLLG STAQRLLLDA       120
     DCPVLAVKAH                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page