(data stored in SCRATCH zone)

EMBL: CP002343.PE47

CP002343.PE47        Location/Qualifiers
FT   CDS             52004..52522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0047"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nca:Noca_3980 hemerythrin
FT                   HHE cation binding domain-containing protein; PFAM:
FT                   Hemerythrin HHE cation binding domain protein; SPTR:
FT                   Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46609"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK8"
FT                   /protein_id="ADU46609.1"
FT                   /translation="MTSPTTTPVERDEAAAATIRRHHEHLVAELETLVAALGTAPGTAP
FT                   GTAPGTRGTDPGEASGSAKARLVDWARTSLAPHAAGEETTFYRTAAGTEAGHLLVAALV
FT                   AEHGVILGIVDAIEASTEPAAAAAWAEALLRVFTSHAAKENDLVLPLLVADPGANLEAL
FT                   LEEMHHEVH"
     MTSPTTTPVE RDEAAAATIR RHHEHLVAEL ETLVAALGTA PGTAPGTAPG TRGTDPGEAS        60
     GSAKARLVDW ARTSLAPHAA GEETTFYRTA AGTEAGHLLV AALVAEHGVI LGIVDAIEAS       120
     TEPAAAAAWA EALLRVFTSH AAKENDLVLP LLVADPGANL EALLEEMHHE VH               172
//

If you have problems or comments...

PBIL Back to PBIL home page