(data stored in SCRATCH zone)

EMBL: CP002343.PE470

CP002343.PE470       Location/Qualifiers
FT   CDS             complement(525802..526329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0485"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: mjl:Mjls_3247 integral membrane protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47032"
FT                   /db_xref="GOA:E6S8R3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R3"
FT                   /protein_id="ADU47032.1"
FT                   /translation="MSDPQVDTTGAAAKPREDRAQYGVCAALAGLGVLLLVDAANIRHV
FT                   TSSNDPLGPRPVPIVLGVLLLITAVSYAIDVWRGGVGQAEGGEDVDLGSRADWKTVGLL
FT                   IVVFGASALLIQPLGWVITGSLLFWGCAYALGNEHHVRGLAFGIALALTTFYGFAIGLG
FT                   VNLPAGILKGIL"
     MSDPQVDTTG AAAKPREDRA QYGVCAALAG LGVLLLVDAA NIRHVTSSND PLGPRPVPIV        60
     LGVLLLITAV SYAIDVWRGG VGQAEGGEDV DLGSRADWKT VGLLIVVFGA SALLIQPLGW       120
     VITGSLLFWG CAYALGNEHH VRGLAFGIAL ALTTFYGFAI GLGVNLPAGI LKGIL            175
//

If you have problems or comments...

PBIL Back to PBIL home page