(data stored in ACNUC7421 zone)

EMBL: CP002343.PE471

CP002343.PE471       Location/Qualifiers
FT   CDS             complement(526332..527372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0486"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: art:Arth_1395 hypothetical
FT                   protein; SPTR: Putative secreted protein; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47033"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R4"
FT                   /protein_id="ADU47033.1"
FT                   /translation="MRAHPTARKASLLTAGIATAALTLSACGATADDTNTNAGASGATG
FT                   GSAAPASGLQIMVPNSPGGGYDTTARTVAKVMETEQITGTVQVFNLPGAGGTVGLQRTV
FT                   NEKGNGKLAMQMGLGVVGAAYTQKSQATLNDTTPIAKLIEEAGAIVVSKDSPYKDITSL
FT                   IDAWKKDPSKVNVGGGSSPGGPDHLLPMRLAKAVGIEPKSVSFISYDGGGELLPAIIGN
FT                   KIAFGASGFGEFLDQVKAGQVKVLAVTSEERIEALPDVPTLKESGVDFLFTNWRGIVAP
FT                   PEISDADQAVWVDALTKMHDSQAWKDEMKKRGWTDAFVTGDEFGTFLKEQDTAVAEILT
FT                   SLGLVS"
     MRAHPTARKA SLLTAGIATA ALTLSACGAT ADDTNTNAGA SGATGGSAAP ASGLQIMVPN        60
     SPGGGYDTTA RTVAKVMETE QITGTVQVFN LPGAGGTVGL QRTVNEKGNG KLAMQMGLGV       120
     VGAAYTQKSQ ATLNDTTPIA KLIEEAGAIV VSKDSPYKDI TSLIDAWKKD PSKVNVGGGS       180
     SPGGPDHLLP MRLAKAVGIE PKSVSFISYD GGGELLPAII GNKIAFGASG FGEFLDQVKA       240
     GQVKVLAVTS EERIEALPDV PTLKESGVDF LFTNWRGIVA PPEISDADQA VWVDALTKMH       300
     DSQAWKDEMK KRGWTDAFVT GDEFGTFLKE QDTAVAEILT SLGLVS                      346
//

If you have problems or comments...

PBIL Back to PBIL home page