(data stored in ACNUC7421 zone)

EMBL: CP002343.PE472

CP002343.PE472       Location/Qualifiers
FT   CDS             527454..529136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0487"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="COGs: COG3290 Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism; InterPro IPR005467:
FT                   IPR013767: IPR003594: IPR004358; KEGG: sco:SCO1137 two
FT                   component system histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Putative
FT                   two component system histidine kinase; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47034"
FT                   /db_xref="GOA:E6S8R5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R5"
FT                   /protein_id="ADU47034.1"
FT                   /translation="MKVEFFVVMRRLRRFTLAGQLLVAQVAILLTVLIAVAFVSLAQSE
FT                   ATFTRTEGRRLFAIAEQLASHPLVRQELAPPQVINALPTVVQGTITQYGLALVSVADSR
FT                   GVVKDSSDPTTEERQLPLGSERVRQGASWTGPMELAGRRMLAAQTPVLYSPGTNVPAAG
FT                   GLSPGTRLGTVMVAVEMPSVIDRLQGASSYLLTYLGLALALGGLGSWLLARRLKRQTLG
FT                   LEPHEITGLAESREAMLFGLAEGVVALDTSNRITLVNNVAQRLLDLPERAVGMSVSDLA
FT                   IGPRLREVLLGQTGDEPDQVVLRRGRVLVMNRMEVAKDGRPLGSVTTLRDRTELAALER
FT                   EIGSFRSSTELLRAQAHEFANQLHTISGLIQLGEYDEVVRFVDSVSQHRAQLDLTVARR
FT                   IQDTAVSALVMAKAAQATERRVELRVSDDTALGRMSSVDSADLAAVVGNLVDNAVDAAA
FT                   TAGGDERWVELAIHQDASSPRSTVEVMVSDSGPGVAPELVTEVFTHGFTTKAAEAGERG
FT                   IGLALTRLICQRRGGEVEVERTEEGATFIARLTVDSPALQESR"
     MKVEFFVVMR RLRRFTLAGQ LLVAQVAILL TVLIAVAFVS LAQSEATFTR TEGRRLFAIA        60
     EQLASHPLVR QELAPPQVIN ALPTVVQGTI TQYGLALVSV ADSRGVVKDS SDPTTEERQL       120
     PLGSERVRQG ASWTGPMELA GRRMLAAQTP VLYSPGTNVP AAGGLSPGTR LGTVMVAVEM       180
     PSVIDRLQGA SSYLLTYLGL ALALGGLGSW LLARRLKRQT LGLEPHEITG LAESREAMLF       240
     GLAEGVVALD TSNRITLVNN VAQRLLDLPE RAVGMSVSDL AIGPRLREVL LGQTGDEPDQ       300
     VVLRRGRVLV MNRMEVAKDG RPLGSVTTLR DRTELAALER EIGSFRSSTE LLRAQAHEFA       360
     NQLHTISGLI QLGEYDEVVR FVDSVSQHRA QLDLTVARRI QDTAVSALVM AKAAQATERR       420
     VELRVSDDTA LGRMSSVDSA DLAAVVGNLV DNAVDAAATA GGDERWVELA IHQDASSPRS       480
     TVEVMVSDSG PGVAPELVTE VFTHGFTTKA AEAGERGIGL ALTRLICQRR GGEVEVERTE       540
     EGATFIARLT VDSPALQESR                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page