(data stored in ACNUC7421 zone)

EMBL: CP002343.PE473

CP002343.PE473       Location/Qualifiers
FT   CDS             529133..529807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0488"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="COGs: COG4565 Response regulator of citrate/malate
FT                   metabolism; InterPro IPR001789; KEGG: sco:SCO1136 two
FT                   component system response regulator; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Putative two component system response regulator;
FT                   PFAM: IclR helix-turn-helix domain; Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47035"
FT                   /db_xref="GOA:E6S8R6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R6"
FT                   /protein_id="ADU47035.1"
FT                   /translation="MISVLVVDDDFMVARIHRGFVSQTEGFEVVGTASSGGEALELVGR
FT                   LKPDLVLLDLYLPDIFGLDVVTRLRAAGETCDVLVITAAKEADSVRAAVRHGVVGYLLK
FT                   PFSRADLEQRLMSYAAERARAVDAGELTQQEIDAAFASGAGGRPAAVSLPKGLSVETAE
FT                   AVLRALREADDTMSATECAEAVGISRVSARRYLEHFVATGAAEVSLRYGATGRPERRYR
FT                   PR"
     MISVLVVDDD FMVARIHRGF VSQTEGFEVV GTASSGGEAL ELVGRLKPDL VLLDLYLPDI        60
     FGLDVVTRLR AAGETCDVLV ITAAKEADSV RAAVRHGVVG YLLKPFSRAD LEQRLMSYAA       120
     ERARAVDAGE LTQQEIDAAF ASGAGGRPAA VSLPKGLSVE TAEAVLRALR EADDTMSATE       180
     CAEAVGISRV SARRYLEHFV ATGAAEVSLR YGATGRPERR YRPR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page