(data stored in ACNUC7421 zone)

EMBL: CP002343.PE476

CP002343.PE476       Location/Qualifiers
FT   CDS             complement(532122..533033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0491"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: tbi:Tbis_0209 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Hydrolase;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47038"
FT                   /db_xref="GOA:E6S8R9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R9"
FT                   /protein_id="ADU47038.1"
FT                   /translation="MPVDAAFVEIDGPWQHRHVAANGARFHVAELGDGPLVLMLHGYPQ
FT                   FWYTWRHQMVSLAEAGYRVAAMDLRGYGGSDKPPRGYDTYTATLDAASVIRALGEAEAT
FT                   IVGQGLGGWIAWAMPALRPDETTAVASLSMPHPRVMRRASWLNRKQRAASSWIVSLQRP
FT                   FGPERAMTRSHDYVGGLLRDWSAPGGDFPTPEDVARYGDAMMIPFVAHSAAEHYRWLGR
FT                   SQLRPDGPFFMRRIRHAIHVPVLELHGADDGCVLVSSIRGSEKYAAGDFRSVTIPRAGH
FT                   FLTEEAPDAVSAELLRWLKSVR"
     MPVDAAFVEI DGPWQHRHVA ANGARFHVAE LGDGPLVLML HGYPQFWYTW RHQMVSLAEA        60
     GYRVAAMDLR GYGGSDKPPR GYDTYTATLD AASVIRALGE AEATIVGQGL GGWIAWAMPA       120
     LRPDETTAVA SLSMPHPRVM RRASWLNRKQ RAASSWIVSL QRPFGPERAM TRSHDYVGGL       180
     LRDWSAPGGD FPTPEDVARY GDAMMIPFVA HSAAEHYRWL GRSQLRPDGP FFMRRIRHAI       240
     HVPVLELHGA DDGCVLVSSI RGSEKYAAGD FRSVTIPRAG HFLTEEAPDA VSAELLRWLK       300
     SVR                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page