(data stored in SCRATCH zone)

EMBL: CP002343.PE478

CP002343.PE478       Location/Qualifiers
FT   CDS             complement(533799..534236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0493"
FT                   /product="PEBP family protein"
FT                   /note="COGs: COG1881 Phospholipid-binding protein; InterPro
FT                   IPR008914: IPR005247; KEGG: drt:Dret_1202 PEBP family
FT                   protein; PFAM: PEBP family protein; SPTR: PEBP family
FT                   protein; PFAM: Phosphatidylethanolamine-binding protein;
FT                   TIGRFAM: Raf kinase inhibitor-like protein, YbhB/YbcL
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47040"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S1"
FT                   /protein_id="ADU47040.1"
FT                   /translation="MKLTSSTFAEGQEIPEKCGKRAQNVSPHLTWSDEPAGTRSFALTV
FT                   VDWHPVARGYVHWMVCDIRPTTTTFMEGAAARGLPEGTRQVRAYAGPFPPSGTHDYVFT
FT                   LHALDIAAPNIPPGATLDEFNAAVSSHTLATATLTGHFTRR"
     MKLTSSTFAE GQEIPEKCGK RAQNVSPHLT WSDEPAGTRS FALTVVDWHP VARGYVHWMV        60
     CDIRPTTTTF MEGAAARGLP EGTRQVRAYA GPFPPSGTHD YVFTLHALDI AAPNIPPGAT       120
     LDEFNAAVSS HTLATATLTG HFTRR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page