(data stored in ACNUC7421 zone)

EMBL: CP002343.PE479

CP002343.PE479       Location/Qualifiers
FT   CDS             complement(534534..535325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0494"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451; KEGG: bcv:Bcav_1182
FT                   acetyltransferase, putative; SPTR: Acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47041"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S2"
FT                   /protein_id="ADU47041.1"
FT                   /translation="MHNIKANKLTIGKGTFIDPSAVICGADGGPADVVTIGDNCYIGER
FT                   VQIRCPEFSLGDYGKIHHDTNVHGYSPCLIGHNAWIGQFTIIDSIGGVTIGDNCGIGAH
FT                   SQLWSHIKYGDTLEGCRFLSEKPLRIGKDVWFVGHCIVSPITAEDRSVAMVGSVVTRDM
FT                   KENRVYAGTPAADITDKTGPAFSPVNVEEKFLKMEEYLKAYGGDRSDLRIARTVNDISD
FT                   VNSTWFVVESRTYTKRGTASEVEFMKFLLPERGKFTPISTL"
     MHNIKANKLT IGKGTFIDPS AVICGADGGP ADVVTIGDNC YIGERVQIRC PEFSLGDYGK        60
     IHHDTNVHGY SPCLIGHNAW IGQFTIIDSI GGVTIGDNCG IGAHSQLWSH IKYGDTLEGC       120
     RFLSEKPLRI GKDVWFVGHC IVSPITAEDR SVAMVGSVVT RDMKENRVYA GTPAADITDK       180
     TGPAFSPVNV EEKFLKMEEY LKAYGGDRSD LRIARTVNDI SDVNSTWFVV ESRTYTKRGT       240
     ASEVEFMKFL LPERGKFTPI STL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page