(data stored in ACNUC7421 zone)

EMBL: CP002343.PE48

CP002343.PE48        Location/Qualifiers
FT   CDS             complement(52573..54456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0048"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="COGs: COG3004 Na+/H+ antiporter; InterPro IPR004670:
FT                   IPR001853: IPR017936; KEGG: nca:Noca_1867 Na+/H+ antiporter
FT                   NhaA; PFAM: Na+/H+ antiporter NhaA; DSBA oxidoreductase;
FT                   SPTR: Na(+)/H(+) antiporter nhaA 2; TIGRFAM: Na+/H+
FT                   antiporter NhaA; PFAM: Na+/H+ antiporter 1; DSBA-like
FT                   thioredoxin domain; TIGRFAM: Na+/H+ antiporter NhaA; TC
FT                   2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46610"
FT                   /db_xref="GOA:E6SEK9"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK9"
FT                   /protein_id="ADU46610.1"
FT                   /translation="MATTTTAPRRHQLGGQLSAPLRRFLATESGGAVLLVVATLVALGW
FT                   ANSTWSETYSRIWSTELAVEVADWALRMDLHHWINDGLMAVFFLVIGLEVRRDLSVGEL
FT                   TDRRKLRLPLLAGLGGMVVPAVLYLLVNSSGEAANGWGVVIGTDTAFLLGTLALVGPAT
FT                   STQLRVFLLTLTVVDDIVAVSVIGLVYSDDLDAVALAVALAAVAVLVALGRSRVWRTWP
FT                   YALTILALWLATVASGLHASVAGMVAGLLVPSFAPRRQAVEQAARRFHAFRQSPLADVG
FT                   RSAQDALVRAVPVNERMQLVLHPWTSYFIVPVFALANAGVDLRGGVLGEALRSPVTWGI
FT                   VLGLVLGKFVGIGGVALLGSRLGVGRLPQGVGPGQILGGGALSGIGFTVSLLIVGLAFG
FT                   PELQDEATVGVLLALVLATLLGWLVFTLAAVLHGETTAGLPTVLDRPVDPERDHVRGSV
FT                   TAPLTLVEYADFECPFCGRATGVVAEVRAHFGADLRYVMRHLPLPDVHPHAELAALAVE
FT                   SAGAQGRFWEMHDLLFEHQGQLETEDLAGYASELGLDVERFLRDLDDEVHSDRIREDVR
FT                   SAEASGARGTPTFFVGDQRHVGPYDAQTLIAELEASRRDPAREERPRAGHA"
     MATTTTAPRR HQLGGQLSAP LRRFLATESG GAVLLVVATL VALGWANSTW SETYSRIWST        60
     ELAVEVADWA LRMDLHHWIN DGLMAVFFLV IGLEVRRDLS VGELTDRRKL RLPLLAGLGG       120
     MVVPAVLYLL VNSSGEAANG WGVVIGTDTA FLLGTLALVG PATSTQLRVF LLTLTVVDDI       180
     VAVSVIGLVY SDDLDAVALA VALAAVAVLV ALGRSRVWRT WPYALTILAL WLATVASGLH       240
     ASVAGMVAGL LVPSFAPRRQ AVEQAARRFH AFRQSPLADV GRSAQDALVR AVPVNERMQL       300
     VLHPWTSYFI VPVFALANAG VDLRGGVLGE ALRSPVTWGI VLGLVLGKFV GIGGVALLGS       360
     RLGVGRLPQG VGPGQILGGG ALSGIGFTVS LLIVGLAFGP ELQDEATVGV LLALVLATLL       420
     GWLVFTLAAV LHGETTAGLP TVLDRPVDPE RDHVRGSVTA PLTLVEYADF ECPFCGRATG       480
     VVAEVRAHFG ADLRYVMRHL PLPDVHPHAE LAALAVESAG AQGRFWEMHD LLFEHQGQLE       540
     TEDLAGYASE LGLDVERFLR DLDDEVHSDR IREDVRSAEA SGARGTPTFF VGDQRHVGPY       600
     DAQTLIAELE ASRRDPAREE RPRAGHA                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page